Recombinant Enterobacteria phage M13 Head virion protein G6P (VI)

Shipped with Ice Packs
In Stock

Description

Role in Phage Assembly

G6P collaborates with G1p and G11p in the inner membrane to form the M13 assembly machine. This oligomeric complex (320 kDa) facilitates:

  • ATP-dependent extrusion of single-stranded DNA .

  • Lateral integration of major coat protein G8P into the growing phage filament .

  • Secretion of progeny virions through the outer membrane secretin G4p .

Host Interaction

G6P contributes to the phage’s base structure alongside G3P, enabling:

  • Adsorption to host E. coli F-pili during infection .

  • Stabilization of the phage tip for efficient DNA transfer .

Recombinant Production

Recombinant G6P is produced via genetic engineering in E. coli using phage vectors or phagemids. Key methodologies include:

  • Phage Vector Systems: Direct insertion of gene VI into M13-derived vectors for stable expression .

  • Phagemid Systems: Co-expression with helper phages to overcome size limitations of exogenous DNA .

  • Purification: Membrane solubilization and affinity chromatography yield multimeric G6P complexes .

Functional Studies

  • Deletion of gene VI abolishes phage infectivity, underscoring G6P’s irreplaceability in host adsorption .

  • Competitive ELISA assays demonstrate that G6P-containing phages bind specifically to host receptors, unlike truncated mutants .

Applications

  • Nanobiotechnology: Engineered M13 phages displaying G6P fusion peptides are used in biosensing and targeted drug delivery .

  • Virology: G6P’s interaction with host membranes informs antiviral strategies against filamentous phages .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
VI; Head virion protein G6P; Coat protein D; G6P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Enterobacteria phage M13 (Bacteriophage M13)
Target Names
VI
Target Protein Sequence
MPVLLGIPLLLRFLGFLLVTLFGYLLTFLKKGFGKIAIAISLFLALIIGLNSILVGYLSD ISAQLPSDFVQGVQLILPSNALPCFYVILSVKAAIFIFDVKQKIVSYLDWDK
Uniprot No.

Target Background

Function
Plays essential roles in both viral genome entry into the bacterial host and the viral budding process. Formation of the G3P-G6P adsorption complex is crucial for proper filamentous phage assembly termination.
Database Links

KEGG: vg:927335

Protein Families
Inovirus G6P protein family
Subcellular Location
Virion. Host membrane; Multi-pass membrane protein. Note=Prior to assembly, G6P is found associated with the bacterial host inner membrane. There are about five copies of G6P in the mature virion. They are located together with G3P at the head side of the filamentous virion.

Q&A

What is the structural organization of M13 bacteriophage and where is G6P (VI) located?

M13 bacteriophage has a distinctive cylindrical structure with a length of approximately 880 nm and a diameter of 6 nm. The phage capsid consists of five different proteins that assemble in a highly organized manner. The body consists of approximately 2700 copies of pVIII (major capsid protein), while at one end of the virus, there are approximately 5 copies each of pIII and pVI proteins. The opposite end contains approximately 5 copies each of pVII and pIX proteins. The G6P (VI) protein is specifically located at one end of the phage particle, contributing to its structural integrity and possibly host interaction functions . This organization creates a filamentous structure that protects the encapsulated single-stranded genome encoding these five different capsid proteins. Understanding this architecture is fundamental to utilizing M13 phage components in various research applications.

How is Recombinant Enterobacteria phage M13 Head virion protein G6P (VI) typically expressed and purified?

Recombinant expression of the full-length G6P (VI) protein typically involves fusion with an N-terminal His-tag in an E. coli expression system. The protein can be expressed using standard bacterial expression protocols with appropriate temperature, induction conditions, and growth media optimizations. After expression, the protein is commonly purified using affinity chromatography (leveraging the His-tag), followed by additional purification steps if necessary .

For optimal results, the following protocol is recommended:

  • Transform expression plasmid containing the G6P (VI) gene with His-tag into a suitable E. coli strain

  • Culture bacteria in appropriate media with antibiotic selection

  • Induce protein expression (typically with IPTG)

  • Harvest cells and lyse using mechanical or chemical methods

  • Purify using Ni-NTA or similar affinity chromatography

  • Perform quality control using SDS-PAGE to confirm purity (should be >90%)

  • Lyophilize the purified protein for storage or prepare in appropriate buffer

The resulting protein is typically obtained as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis .

What are the optimal storage and handling conditions for Recombinant G6P (VI) protein?

For long-term storage and optimal stability of the Recombinant G6P (VI) protein, the following conditions are recommended:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For buffer conditions, a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is recommended

It is important to note that repeated freezing and thawing is not recommended as it can compromise protein integrity and activity. Before opening, the vial should be briefly centrifuged to bring the contents to the bottom . These handling precautions ensure that the structural and functional properties of the protein remain intact for research applications.

How can M13 bacteriophage and its G6P (VI) protein be utilized for single-molecule biophysics studies?

M13 bacteriophage provides an excellent platform for single-molecule biophysical studies due to its well-defined structure and mechanical properties. To utilize M13 phage and specifically the G6P (VI) protein in such studies:

  • Genetically engineer constructs to display different reactive species at each filament end (including modifications to G6P)

  • Create hetero-functional particles that can tether microscopic beads in solution

  • Use optical traps with nanometer-scale position resolution to measure biopolymer elasticity

  • Apply force-extension measurements to characterize the mechanical properties

Studies have shown that M13 bacteriophage has a mean persistence length of approximately 1,265 nm and a stretching modulus roughly twice that of dsDNA. These properties make it particularly suitable for higher force studies, such as protein extension and distortion experiments .

The versatile linkage capabilities and load-bearing properties of the M13 system make it an attractive candidate for use in tethered bead architectures for various biophysical studies. The G6P (VI) protein, as one of the terminal proteins, can be specifically targeted for modification to create these experimental systems.

What methods are available for chemical modification of G6P (VI) for targeted applications?

Sortase-mediated chemo-enzymatic reactions provide a powerful approach for modifying the G6P (VI) protein for various applications. This method allows:

  • Covalent attachment of diverse moieties to the N-terminus of phage proteins including G6P (VI)

  • Incorporation of functional groups such as biotin, fluorophores, or other proteins

  • Precise control over the site of modification

  • Maintenance of protein function after modification

The sortase A enzyme-based strategy has demonstrated vast improvement over traditional methods in terms of the number of displayed peptides and proteins that can be attached to phage proteins. This approach enables researchers to create novel functionalities for the G6P (VI) protein beyond what can be achieved through genetic engineering alone .

For implementation, researchers typically:

  • Express recombinant sortase A enzyme

  • Prepare the G6P (VI) protein with appropriate recognition sequences

  • Synthesize peptides containing the nucleophile (often oligoglycine)

  • Perform the transpeptidation reaction under controlled conditions

  • Purify the modified protein products

This method extends the versatility of M13 as a display platform and enables numerous applications in biosensing, targeted delivery, and nanomaterials.

How can G6P (VI) protein be incorporated into biosensor development?

The G6P (VI) protein can be leveraged for biosensor development through several approaches:

  • Phage Display Technology: By genetically modifying the G6P coding sequence, peptides with specific binding affinities can be displayed on the phage surface. This allows screening for peptides that bind to specific target materials or biomolecules .

  • Self-Assembly Structures: M13 phage proteins, including G6P (VI), can be used to create self-assembling nanostructures that serve as the foundation for biosensor platforms.

  • Material-Specific Binding: Through proper engineering, M13 phage displaying modified G6P (VI) can be made to bind specifically to various materials including GaAs, GaN, Ag, Pt, Au, Pd, Ge, Ti, SiO2, quartz, CaCO3, ZnS, CdS, Co, TiO2, ZnO, CoPt, FePt, BaTiO3, CaMoO4, and hydroxyapatite .

  • Carbon Nanomaterial Integration: Modified phage proteins can be engineered to interact with carbon-based nanomaterials such as C60, graphene, and carbon nanotubes, expanding the range of sensing platforms .

The integration of these approaches allows for the development of highly specific biosensors that can detect various analytes ranging from biological molecules to environmental contaminants.

What computational approaches can be used to analyze G6P (VI) protein within the context of the M13 peptidase family?

Bioinformatic analysis of G6P (VI) protein can be conducted using several computational approaches:

  • Multiple Sequence Alignment: Programs like MUSCLE can align G6P (VI) with related proteins to identify areas of strong local homology, particularly in catalytic regions that show strong conservation despite high variability in other regions .

  • Phylogenetic Analysis: This approach helps to unravel the functional and evolutionary relationships of G6P (VI) within the M13 peptidase family. Various algorithms can be used to construct phylogenetic trees that illustrate these relationships .

  • Homology Modeling: In the absence of crystal structures, homology modeling can predict the three-dimensional structure of G6P (VI) based on the known structures of related proteins.

  • Identification of Conserved Catalytic Residues: Manual analysis of alignments can determine the conservation of key catalytic residues as defined by mutagenesis studies and crystal structures of related proteins like human neprilysin .

The analysis workflow typically involves:

  • Gathering protein sequences using BLASTP, PSI-BLAST, and Hidden Markov Models (HMMs)

  • Creating multiple sequence alignments

  • Removing uninformative insertions from the alignment

  • Analyzing conservation patterns of key functional residues

  • Building phylogenetic trees to understand evolutionary relationships

These computational approaches provide insights into the functional domains, evolutionary history, and potential interaction partners of G6P (VI), informing experimental design and interpretation.

How do post-translational modifications affect G6P (VI) function in research applications?

Post-translational modifications (PTMs) of G6P (VI) can significantly impact its functionality in research applications, though this area remains less extensively studied than genetic modifications. When considering PTMs for G6P (VI):

  • Natural PTMs: The native G6P (VI) protein may undergo limited natural post-translational processing during phage assembly.

  • Engineered PTMs: More relevant to research applications are the engineered modifications that can be introduced through:

    • Sortase-mediated transpeptidation (as previously discussed)

    • Chemical conjugation to exposed residues

    • Enzymatic modifications using various transferases

  • Functional Impact: These modifications can affect:

    • Protein stability and solubility

    • Binding affinity to target molecules

    • Assembly properties within the phage particle

    • Detection sensitivity in biosensor applications

When designing experiments involving modified G6P (VI), researchers should carefully consider how these modifications might alter the protein's native properties and potentially introduce experimental artifacts. Appropriate controls with unmodified protein should be included to isolate the effects of the modifications.

What are common challenges in expression and purification of Recombinant G6P (VI) protein and how can they be addressed?

Researchers commonly encounter several challenges when working with Recombinant G6P (VI) protein:

  • Low Expression Yield:

    • Optimize codon usage for E. coli expression

    • Test different E. coli strains (BL21(DE3), Rosetta, C41/C43)

    • Adjust induction conditions (temperature, IPTG concentration, duration)

    • Consider using specialized expression vectors with strong promoters

  • Protein Solubility Issues:

    • Express at lower temperatures (16-20°C)

    • Include solubility-enhancing tags (SUMO, MBP, TrxA)

    • Add solubilizing agents to lysis buffer (mild detergents, higher salt)

    • Consider refolding protocols if inclusion bodies form

  • Purification Challenges:

    • Optimize imidazole concentration in binding and wash buffers to reduce non-specific binding

    • Include multiple purification steps (ion exchange, size exclusion)

    • Add reducing agents if disulfide bond formation is an issue

    • Test different buffer compositions to improve stability

  • Protein Instability:

    • Identify optimal buffer conditions through stability screening

    • Include protease inhibitors during purification

    • Add stabilizing agents like glycerol, trehalose, or specific ions

    • Store in small aliquots to avoid repeated freeze-thaw cycles

A systematic approach to troubleshooting, with careful documentation of each condition tested, will help researchers optimize their specific expression and purification protocols for G6P (VI) protein.

How can researchers validate the structural integrity and functionality of purified G6P (VI) protein?

To ensure that purified G6P (VI) protein maintains its structural integrity and functionality, researchers should implement a multi-faceted validation approach:

  • Biochemical Characterization:

    • SDS-PAGE to confirm size and purity (>90% purity is typically desired)

    • Western blot using anti-His tag or specific G6P antibodies

    • Mass spectrometry to confirm the exact molecular weight and sequence

    • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Functional Assays:

    • Binding assays with known interaction partners

    • Assembly assays to test incorporation into phage-like particles

    • Activity assays relevant to the specific research application

  • Structural Analysis:

    • Dynamic light scattering to assess homogeneity

    • Size exclusion chromatography to confirm monomeric state

    • More advanced techniques like X-ray crystallography or NMR for detailed structural information

  • Stability Assessment:

    • Thermal shift assays to determine melting temperature

    • Time-course stability studies under various storage conditions

    • Freeze-thaw stability tests

A well-validated protein preparation ensures reliable and reproducible results in downstream applications and reduces the likelihood of experimental artifacts due to protein degradation or misfolding.

What emerging applications of M13 phage and G6P (VI) protein show promise in biotechnology research?

Several cutting-edge applications for M13 phage and its G6P (VI) protein are emerging in biotechnology research:

  • Advanced Biosensing Platforms:

    • Integration with nanomaterials for ultrasensitive detection

    • Development of multimodal sensors combining optical, electrical, and mechanical detection

    • Real-time, label-free biosensing approaches

  • Therapeutic Applications:

    • Targeted drug delivery systems using modified phage proteins

    • Vaccine development platforms

    • Combating multidrug-resistant bacterial infections

  • Nanotechnology Integration:

    • Self-assembling nanomaterials with programmable properties

    • Conductive nanowires and bioelectronic interfaces

    • Templated synthesis of inorganic materials with precise control

  • Single-Molecule Technologies:

    • Advanced tethered bead architectures for biophysical studies

    • Protein extension and distortion studies

    • Force-sensing applications in molecular biology

These emerging applications leverage the unique structural properties and genetic malleability of M13 phage and its constituent proteins like G6P (VI). As new methods for protein engineering, phage display, and sortase-mediated modifications continue to develop, the utility of these systems in biotechnology will likely expand further .

How might structural engineering of G6P (VI) protein enhance its research applications?

Structural engineering of G6P (VI) protein presents numerous opportunities to enhance its research applications:

  • Domain Fusion Strategies:

    • Creating chimeric proteins by fusing G6P (VI) with functional domains from other proteins

    • Developing split-protein complementation systems for protein-protein interaction studies

    • Engineering sensor domains that respond to specific stimuli

  • Enhancing Stability and Solubility:

    • Rational design of mutations to improve thermal stability

    • Surface engineering to increase solubility while maintaining function

    • Creation of disulfide bonds to stabilize tertiary structure

  • Tailoring Binding Properties:

    • Engineering specific binding sites for target molecules

    • Enhancing affinity and specificity through directed evolution

    • Creating allosteric regulation mechanisms

  • Bio-orthogonal Chemistry Integration:

    • Introduction of non-canonical amino acids for click chemistry applications

    • Development of photocrosslinking capabilities

    • Engineering sites for specific chemical modifications

These structural engineering approaches could transform G6P (VI) from a primarily structural protein into a multifunctional research tool with applications ranging from molecular imaging to synthetic biology. Systematic application of protein engineering techniques, combined with high-throughput screening methods, would facilitate the development of G6P (VI) variants with enhanced or novel properties for specific research applications.

How does protein expression in bacterial systems compare with other expression platforms for G6P (VI)?

Expression SystemAdvantages for G6P (VI)LimitationsTypical YieldPost-translational Modifications
E. coli- Rapid growth
- Cost-effective
- Well-established protocols
- High expression levels
- Compatibility with His-tag purification
- Limited post-translational modifications
- Potential inclusion body formation
- Endotoxin contamination concerns
10-50 mg/L cultureMinimal; primarily limited to disulfide bond formation
Yeast (S. cerevisiae, P. pastoris)- Eukaryotic processing
- Secretion capability
- Medium-scale production
- Proper folding environment
- Longer expression time
- Hyperglycosylation potential
- More complex media requirements
5-20 mg/L cultureModerate; includes glycosylation, phosphorylation
Insect Cells- Enhanced folding machinery
- More native-like processing
- Suitable for complex proteins
- Higher cost
- Specialized equipment needs
- Longer expression timeline
1-10 mg/L cultureExtensive; similar to mammalian cells but with differences in glycosylation patterns
Cell-Free Systems- Rapid expression (hours)
- Direct access to reaction conditions
- Avoids toxicity issues
- Higher cost
- Limited scale
- Shorter protein stability
0.5-5 mg/mL reactionMinimal to none; can be engineered with supplementation

What analytical techniques are most effective for characterizing G6P (VI) interactions with other molecules?

Analytical TechniqueInformation ObtainedSensitivitySample RequirementsAdvantagesLimitations
Surface Plasmon Resonance (SPR)- Binding kinetics (kon, koff)
- Affinity constants (KD)
- Thermodynamics
Nanomolar to picomolarPurified G6P (VI) and binding partnersReal-time, label-free detectionSurface immobilization may affect binding properties
Isothermal Titration Calorimetry (ITC)- Binding stoichiometry
- Complete thermodynamic profile
- Heat changes during binding
Micromolar to nanomolarRelatively large amounts of purified proteinsSolution-based, no immobilization or labelingHigh protein consumption, lower sensitivity
Bio-Layer Interferometry (BLI)- Binding kinetics
- Concentration analysis
- Epitope mapping
Nanomolar rangeModerate protein amountsReal-time analysis, low sample consumptionMay require protein immobilization
Microscale Thermophoresis (MST)- Binding affinities
- Stoichiometry
- Conformational changes
Picomolar to millimolarSmall sample volumes, one component needs labelingWide affinity range, minimal sample consumptionRequires fluorescent labeling of one component
Fluorescence Anisotropy- Binding affinities
- Screening for inhibitors
Nanomolar rangeSmall volumes, fluorescently labeled componentsSolution-based, equilibrium measurementsRequires fluorescent labeling, size-dependent sensitivity
AlphaScreen/AlphaLISA- High-throughput binding analysis
- Inhibitor screening
Femtomolar to nanomolarDonor and acceptor bead conjugationExtremely sensitive, homogeneous assay formatPotential interference from assay components

For G6P (VI) interactions, the choice of analytical technique depends on the specific research question, available sample quantities, and required information. SPR and BLI are particularly valuable for kinetic characterization, while ITC provides comprehensive thermodynamic insights. For high-throughput applications, AlphaScreen or fluorescence-based methods may be preferred.

How can G6P (VI) protein research benefit from advances in structural biology techniques?

Recent advances in structural biology offer new opportunities to enhance G6P (VI) protein research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Visualization of G6P (VI) in the context of the complete M13 phage structure

    • Analysis of conformational changes upon binding to target molecules

    • Structural determination without crystallization

    • Resolution of dynamic assemblies and protein complexes

  • Integrative Structural Biology:

    • Combining multiple techniques (X-ray crystallography, NMR, SAXS, Cryo-EM)

    • Development of comprehensive structural models across different scales

    • Integration of computational predictions with experimental data

  • Time-Resolved Structural Methods:

    • Capturing structural changes during functional processes

    • Analysis of folding pathways and intermediate states

    • Monitoring structural responses to environmental conditions

  • Advanced NMR Techniques:

    • Solid-state NMR for membrane-associated forms of G6P (VI)

    • Relaxation dispersion experiments to detect conformational exchange

    • In-cell NMR to study behavior in cellular environments

These advanced structural biology approaches can reveal previously unknown aspects of G6P (VI) structure and function, particularly in the context of the intact phage particle or when involved in complex assemblies. The structural insights gained can inform rational design efforts and provide mechanistic understanding of G6P (VI) interactions.

What role might G6P (VI) play in emerging phage-based diagnostic technologies?

G6P (VI) protein has significant potential in advancing phage-based diagnostic technologies:

  • Phage-Based Mass Spectrometry Applications:

    • Modified G6P (VI) can serve as a specific capture element for target analytes

    • Integration into MS workflows for rapid analysis and characterization

    • Development of targeted detection methods for specific pathogens

  • Biosensor Development:

    • G6P (VI) modifications for specific target recognition

    • Integration into electrical, optical, or mechanical sensing platforms

    • Creation of stable, long-shelf-life diagnostic reagents

  • Bacterial Detection Systems:

    • Phage amplification-based detection utilizing modified G6P (VI)

    • Specific identification of bacterial species or strains

    • Development of field-deployable detection systems

  • Multiplexed Detection Platforms:

    • Arrays of differently modified G6P (VI) proteins for simultaneous detection of multiple targets

    • Integration with microfluidic systems for automated analysis

    • Development of point-of-care diagnostic devices

The unique properties of M13 phage and its G6P (VI) protein, including stability, specificity, and amenability to modification, make it an attractive component for next-generation diagnostic technologies. As these technologies continue to evolve, G6P (VI) may play an increasingly important role in creating sensitive, specific, and robust detection systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.