Recombinant Enterobacteria phage M13 Virion export protein (IV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
IV; Virion export protein; Gene 4 protein; G4P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-426
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage M13 (Bacteriophage M13)
Target Names
IV
Target Protein Sequence
QVIEMNNSPLRDFVTWYSKQSGESVIVSPDVKGTVTVYSSDVKPENLRNFFISVLRANNF DMVGSIPSIIQKYNPNNQDYIDELPSSDNQEYDDNSAPSGGFFVPQNDNVTQTFKINNVR AKDLIRVVELFVKSNTSKSSNVLSIDGSNLLVVSAPKDILDNLPQFLSTVDLPTDQILIE GLIFEVQQGDALDFSFAAGSQRGTVAGGVNTDRLTSVLSSAGGSFGIFNGDVLGLSVRAL KTNSHSKILSVPRILTLSGQKGSISVGQNVPFITGRVTGESANVNNPFQTIERQNVGISM SVFPVAMAGGNIVLDITSKADSLSSSTQASDVITNQRSIATTVNLRDGQTLLLGGLTDYK NTSQDSGVPFLSKIPLIGLLFSSRSDSNEESTLYVLVKATIVRAL
Uniprot No.

Target Background

Function

This protein functions in bacteriophage assembly and extrusion by forming a channel across the host outer membrane. This channel facilitates the passage of newly synthesized phage particles. Extrusion, a simultaneous assembly and secretion process, occurs at specific sites where the host inner and outer membranes are in close proximity.

Database Links

KEGG: vg:927337

Protein Families
Inovirus G4P protein family
Subcellular Location
Host membrane; Single-pass type I membrane protein.

Q&A

How does the M13 phage export machinery function at the molecular level?

The M13 phage export process involves a complex interplay between viral and host proteins. While the search results don't directly address protein IV function, insights into protein export mechanisms reveal several key principles:

  • Membrane association: Phage proteins involved in export associate with the inner membrane fraction of the bacterial cell, creating assembly sites .

  • Electrophoretic mechanisms: Pre-proteins are discharged into the periplasm through electrophoretic discharge across the inner membrane, influenced by:

    • The nature and positioning of charged amino acid residues in the early mature portion of proteins

    • The prevailing membrane energization state

    • Composition of the proximal sequence around key amino acids

  • Charge effects: The distribution of charges significantly impacts export efficiency. Research shows:

    • Increasing positive residues at the amino terminus severely impedes protein export

    • Negatively charged residues can enhance export when properly positioned

    • Proline residues within neutral peptide appendages can slightly enhance export

The export process requires precise coordination between the virion proteins and host cellular machinery, with the virion export protein functioning as a critical component for phage assembly and release.

What distinguishes protein IV from other M13 phage proteins in terms of structure and function?

While the major coat protein (pVIII) and the attachment protein (pIII) are well-characterized components of the M13 virion, protein IV has distinct properties as an export protein:

Structural differences:

  • Not incorporated into the mature virion structure

  • Associates with the bacterial inner membrane rather than the phage capsid

  • Functions as part of the export machinery rather than as a structural element

Functional differences:

  • Essential for phage assembly and release rather than infection or genome protection

  • Forms a channel-like structure in the host membrane for phage export

  • May interact with both phage components and host membrane systems

Molecular characteristics:

  • Contains membrane-spanning domains

  • Works in concert with other proteins in the export complex

  • Likely undergoes conformational changes during the export process

Unlike pIII, which has dual functions in both attachment and potentially in membrane-oriented DNA synthesis , protein IV is specialized for the assembly and export process of newly synthesized phage particles.

What are the most effective methods for expressing and purifying recombinant M13 phage protein IV?

Based on successful approaches with other M13 proteins, the following methodologies are recommended for protein IV:

Expression systems:

  • Yeast expression system: Particularly effective for producing complex phage proteins with proper folding and post-translational modifications

  • Bacterial systems with optimized export sequences: Using directed evolution strategies to identify ideal export sequences

Expression optimization:

  • Signal sequence engineering:

    • Optimize charge distribution in the early mature region

    • Consider introducing negative charges which may enhance export

    • Avoid multiple positive charges which impede export efficiency

  • Construct design:

    • N-terminal 6xHis-tag for purification purposes

    • Inclusion of appropriate folding domains if membrane protein solubility is problematic

Purification protocol:

  • Cell lysis under conditions that solubilize membrane proteins

  • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin

  • Size exclusion chromatography for further purification

  • Quality assessment by SDS-PAGE (>90% purity achievable)

Quality control measures:

  • Functional assays to verify biological activity

  • Mass spectrometry for sequence verification

  • Circular dichroism to assess proper folding

How can researchers effectively study protein-protein interactions involving M13 phage export proteins?

Several complementary approaches can be employed to investigate interactions between protein IV and other components of the export machinery:

Genetic approaches:

  • Mutational analysis: Create targeted mutations in protein IV to identify key residues

  • Suppressor screens: Identify compensatory mutations that restore function

  • Two-hybrid assays: Detect interactions with other phage or host proteins

Biochemical methods:

  • Co-immunoprecipitation:

    • Express tagged versions of potential interaction partners

    • Pull down protein complexes using antibodies against the tags

    • Identify interacting proteins by mass spectrometry

  • Cross-linking studies:

    • Use chemical cross-linkers to stabilize transient interactions

    • Identify cross-linked peptides by mass spectrometry

    • Map interaction interfaces at amino acid resolution

Structural biology techniques:

  • Cryo-EM: Visualize protein complexes in near-native states

  • X-ray crystallography: Obtain high-resolution structures of protein domains

  • NMR: Study dynamics and interactions of smaller protein fragments

Single-molecule approaches:

  • Optical trapping: Study mechanical properties and conformational changes

  • FRET (Förster Resonance Energy Transfer): Monitor distance changes between interacting components

  • AFM (Atomic Force Microscopy): Visualize complexes and measure interaction forces

What experimental systems best model the native environment for studying M13 phage export mechanisms?

To accurately study M13 phage export mechanisms, researchers should consider experimental systems that closely mimic the native membrane environment:

Membrane-mimetic systems:

  • Reconstituted proteoliposomes:

    • Incorporate purified protein IV into artificial lipid bilayers

    • Control lipid composition to match E. coli inner membrane

    • Monitor protein function through vesicle permeabilization assays

  • Nanodiscs:

    • Stabilize membrane proteins in disc-like phospholipid bilayers

    • Allow for controlled oligomerization and interaction studies

    • Compatible with various biophysical techniques

Cellular systems:

  • E. coli spheroplasts:

    • Remove outer membrane while preserving inner membrane

    • Allow access to both sides of the inner membrane

    • Monitor phage export in real-time using fluorescently labeled components

  • Inner membrane vesicles (IMVs):

    • Derived directly from E. coli cells

    • Maintain native membrane protein composition

    • Suitable for reconstitution experiments

Advanced imaging approaches:

  • Super-resolution microscopy: Visualize export sites in infected cells

  • Single-particle tracking: Monitor dynamics of export components

  • Correlative light-electron microscopy: Combine functional and structural data

Data collection parameters:

Experimental SystemAdvantagesLimitationsTypical Measurements
ProteoliposomesDefined compositionArtificial curvatureChannel activity, protein orientation
E. coli spheroplastsNative membraneComplex backgroundExport kinetics, protein localization
Inner membrane vesiclesNative protein environmentInside-out orientationProtein interactions, export activity
NanodiscsStable for structural studiesSize constraintsProtein structure, binding affinities

How can directed evolution approaches improve the functionality of recombinant M13 phage export proteins?

Directed evolution offers powerful strategies for optimizing export protein functionality:

Methodology framework:

  • Library construction:

    • Random mutagenesis of protein IV coding sequence

    • Introduction of random peptide appendages between signal sequence and mature protein

    • DNA shuffling between homologous export proteins from related phages

  • Selection strategies:

    • Chromogenic reporter systems to visualize export efficiency

    • Phage infectivity assays to measure functional export

    • Survival-based selection in engineered bacterial strains

  • Iterative improvement:

    • Multiple rounds of selection with increasing stringency

    • Recombination of beneficial mutations

    • Fine-tuning through targeted mutagenesis

Key optimization parameters:

  • Export efficiency: Select for variants with enhanced phage release

  • Stability: Improve folding and membrane integration

  • Host range: Develop variants that function in diverse bacterial strains

Successful applications:
Research has demonstrated that directed evolution strategies introducing random peptide appendages between a signal sequence and mature region can identify optimal "algorithms" for protein export, achieving recombinant protein secretion in excess of several mg/L under standard batch conditions .

Analysis of evolved variants:

  • Sequencing to identify beneficial mutations

  • Structural studies to understand mechanism of improvement

  • Biochemical characterization to quantify enhanced function

What role does the M13 phage export system play in phage display technology applications?

The M13 phage export system is integral to phage display technology, with protein IV playing a crucial behind-the-scenes role:

Fundamental contributions:

  • The export machinery, including protein IV, ensures efficient assembly and release of phage particles displaying foreign peptides or proteins .

  • The system maintains compatibility with diverse fusion proteins while preserving phage infectivity.

  • Efficient export is essential for library amplification between selection rounds.

Applications enabled:

  • Protein interaction studies: Mapping protein-protein interaction interfaces

  • Antibody development: Generation and optimization of antibody fragments

  • Peptide-based drugs: Identification of peptides with specific binding properties

  • Molecular engineering: Creation of novel binding molecules

Optimization strategies:

  • Export sequence engineering:

    • Consideration of charge distribution in early mature region

    • Incorporation of export-enhancing elements

  • Display scaffolds:

    • Selection of appropriate coat protein for fusion (pIII or pVIII)

    • Development of dual-display systems

    • Engineering of linker regions

Technical considerations:

  • Library construction strategies affect display quality and phage viability

  • Export efficiency influences library diversity maintenance

  • Selection conditions must be optimized for desired binding properties

The successful application of phage display technology ultimately depends on the efficient functioning of the M13 export machinery to produce viable phage particles displaying the proteins or peptides of interest.

How might structural insights into M13 phage export proteins inform the development of novel antibacterial strategies?

Understanding the structure-function relationship of M13 phage export proteins could lead to innovative antibacterial approaches:

Potential therapeutic targets:

  • Export machinery disruption:

    • Small molecules targeting protein IV could block phage assembly

    • Peptides mimicking key interaction interfaces could disrupt essential protein-protein interactions

    • Engineering phage variants with modified export proteins that compete with wild-type phage

  • Bacterial secretion system targeting:

    • Homology between phage export systems and bacterial secretion machineries

    • Inhibitors designed based on phage export protein structure might block bacterial secretion

    • Cross-species applications for antibacterial development

Structural insights enabling drug design:

  • High-resolution structures from cryo-EM studies provide templates for in silico drug screening

  • Identification of critical functional domains and residues

  • Understanding of conformational changes during the export process

Novel therapeutic modalities:

  • Engineered phage variants:

    • Modified export systems for enhanced bacterial targeting

    • Delivery vehicles for antimicrobial payloads

    • "Trojan horse" strategies utilizing the natural infection process

  • Chimeric export systems:

    • Hybrid systems combining elements from different phages

    • Enhanced efficiency or altered host specificity

    • Novel applications in synthetic biology

Experimental validation approaches:

  • High-throughput screening of compound libraries against purified export proteins

  • Bacterial growth inhibition assays with identified candidates

  • Resistance development monitoring to assess therapeutic potential

What factors most commonly affect the efficiency of M13 phage export, and how can researchers address these challenges?

Several key factors influence M13 phage export efficiency, with corresponding strategies to overcome common challenges:

Sequence-based factors:

  • Charge distribution in early mature region:

    • Challenge: Excessive positive charges severely impede export

    • Solution: Engineer sequences with neutral or negative charges at critical positions

    • Implementation: Systematic mutation of charged residues followed by export efficiency assays

  • Proximal sequence composition:

    • Challenge: Suboptimal amino acid context around key residues

    • Solution: Incorporate proline residues within neutral peptide appendages

    • Implementation: Directed evolution to identify optimal sequence contexts

Physiological factors:

  • Membrane energization state:

    • Challenge: Insufficient membrane potential for electrophoretic discharge

    • Solution: Optimize growth conditions to maintain proper energization

    • Implementation: Media composition adjustments and growth phase optimization

  • Host cell stress responses:

    • Challenge: Stress-induced changes in membrane composition or energy status

    • Solution: Controlled induction and growth parameters

    • Implementation: Temperature-shift protocols and carbon source optimization

Technical troubleshooting guide:

IssuePossible CausesDiagnostic ApproachSolution Strategy
Low phage yieldPoor export efficiencyCompare extracellular vs. intracellular phage titersOptimize export sequence based on charge distribution
Structural defects in phageImproper assemblyElectron microscopy examinationAdjust membrane composition through media supplements
Reduced infectivityExport protein dysfunctionComplementation with wild-type proteinEngineer chimeric export proteins with enhanced function
Host cell lysisExcessive membrane stressMonitor growth curves and viabilityReduce expression levels or implement fed-batch strategies

Advanced analytical approaches:

  • Quantitative proteomics to measure export protein levels

  • Membrane fractionation to assess localization

  • Real-time monitoring of phage production kinetics

How can researchers distinguish between defects in protein IV function versus other components of the M13 phage life cycle?

Differentiating between protein IV defects and other issues requires systematic experimental approaches:

Genetic complementation strategies:

  • Trans-complementation:

    • Provide wild-type protein IV from a separate plasmid

    • Compare phage production with and without complementation

    • Restoration of function confirms protein IV as the limiting factor

  • Domain-specific complementation:

    • Express specific domains of protein IV to identify functional regions

    • Use chimeric proteins combining domains from functional and non-functional variants

    • Map critical regions through systematic complementation experiments

Biochemical differentiation methods:

  • Stage-specific analysis:

    • Detect ssDNA accumulation to assess genome replication

    • Quantify assembled intracellular phage particles

    • Measure membrane-associated phage intermediates

    • Compare extracellular phage titers

  • Protein interaction mapping:

    • Analyze protein IV interactions with other phage components

    • Compare wild-type and mutant protein interaction networks

    • Identify disrupted interactions through pulldown assays

Microscopy-based approaches:

  • Immunofluorescence localization:

    • Visualize protein IV distribution in infected cells

    • Compare with other phage proteins

    • Detect abnormal localization patterns

  • Electron microscopy:

    • Examine membrane structures in infected cells

    • Identify accumulated assembly intermediates

    • Correlate ultrastructural features with functional defects

Functional assay cascade:

Process StageAssay MethodExpected Result (Normal)Indicative of Protein IV Defect
DNA ReplicationqPCR for phage ssDNASignificant increase post-infectionNormal replication, impaired export
Protein ProductionWestern blot for phage proteinsDetection of all phage proteinsNormal protein production, specific export defect
Membrane AssociationMembrane fractionationPhage proteins in membrane fractionAbnormal membrane association patterns
Particle AssemblyIntracellular phage titerLow intracellular phage accumulationHigh intracellular, low extracellular phage titers
Phage ExportExtracellular phage titerHigh extracellular phage titersSeverely reduced extracellular phage

What emerging technologies are advancing our understanding of M13 phage export mechanisms?

The field is witnessing rapid technological advancements that are providing unprecedented insights into phage export mechanisms:

Advanced structural techniques:

  • Cryo-electron tomography:

    • Visualize export machinery in situ within bacterial membranes

    • Capture different states of the export process

    • Resolve 3D architecture at near-atomic resolution

  • Integrative structural biology:

    • Combine data from cryo-EM, X-ray crystallography, and computational modeling

    • Generate comprehensive structural models of the export machinery

    • Predict conformational changes during the export cycle

Single-molecule approaches:

  • Optical trapping and nanomechanical measurements:

    • Measure forces involved in phage export processes

    • Characterize mechanical properties with nanometer-scale resolution

    • Detect conformational changes during protein function

  • Single-molecule fluorescence:

    • Track movement of individual components in real-time

    • Measure assembly and export kinetics at single-particle level

    • Detect rare events and heterogeneity in export processes

Advanced genetic technologies:

  • CRISPR-based screening:

    • Systematically identify host factors involved in phage export

    • Generate and screen comprehensive mutation libraries

    • Rapidly assess functional consequences of genetic modifications

  • High-resolution genetic mapping:

    • Deep mutational scanning of protein IV

    • Correlate sequence variations with functional outcomes

    • Generate detailed structure-function maps

Computational approaches:

  • Molecular dynamics simulations:

    • Model membrane protein behavior in lipid bilayers

    • Predict effects of mutations on protein structure and function

    • Simulate the complete export process

  • Machine learning applications:

    • Identify patterns in experimental data that predict export efficiency

    • Design optimized export sequences based on existing data

    • Develop predictive models of phage-host interactions

These emerging technologies promise to transform our understanding of the molecular details of M13 phage export, potentially leading to novel applications in biotechnology, medicine, and materials science.

What are the most significant open questions regarding M13 phage export protein function and mechanism?

Despite decades of research, several fundamental questions remain about M13 phage export protein (IV) and the export process:

  • Structural transitions: How does the protein IV structure change during the export process to facilitate phage passage through the membrane without compromising cellular integrity?

  • Energy coupling: What is the precise mechanism by which membrane potential is harnessed for electrophoretic discharge of pre-proteins into the periplasm , and how is this energy utilized during phage export?

  • Protein-protein interactions: What is the complete interaction network between protein IV and other phage components, particularly pIII which has been implicated in both infection and DNA replication processes ?

  • Host factors: Which host proteins are essential for proper export function, and how do they interact with the phage export machinery?

  • Regulatory mechanisms: How is the export process coordinated with other aspects of the phage life cycle, including DNA replication and protein synthesis?

  • Evolutionary relationships: What can comparative studies of export systems in related filamentous phages reveal about functional conservation and specialization?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and advanced imaging techniques.

How might engineered M13 phage export systems contribute to synthetic biology applications?

Engineered M13 phage export systems offer exciting possibilities for synthetic biology:

Protein secretion platforms:

  • Creation of high-efficiency protein export "chassis" based on optimized sequences identified through directed evolution

  • Development of modular systems for targeting specific subcellular compartments

  • Design of orthogonal secretion pathways for simultaneous production of multiple proteins

Nanomaterial production:

  • Controlled assembly and export of engineered phage particles with modified coat proteins

  • Production of functionalized nanowires with precise dimensions and surface properties

  • Self-assembling materials with programmable composition and structure

Cell-cell communication systems:

  • Engineered phage export machinery for controlled release of signaling molecules

  • Development of synthetic bacterial consortia using phage-based communication

  • Creation of bacterial sensors with phage-mediated signal amplification

Therapeutic delivery applications:

  • Engineered phage particles for targeted drug delivery

  • Export systems designed for continuous production of therapeutic proteins in situ

  • Self-assembling delivery systems with programmable release properties

Future implementation considerations:

  • Standardization of phage export components as BioBrick-compatible parts

  • Development of computational tools for predicting export efficiency

  • Creation of libraries of characterized export sequences for different applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.