Recombinant Salmonella phage P22 Bactoprenol glucosyl transferase (gtrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its development.
Synonyms
gtrB; Bactoprenol glucosyl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella phage P22 (Bacteriophage P22)
Target Names
gtrB
Target Protein Sequence
MKISLVVPVFNEEDTIPIFYKTVREFNELKEYEIEIVFINDGSKDATESIINKIAASDPL VIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMSRAVVENIKQMPERNLFMKGV LSWVGGKTDVVKYARAERVAGDSKFNGWKLWNLALEGITSFSTFPLRIWTYIGLFIAGMS FLYGAWMIIDKLIFGNNVPGYPSLLVSVLFLGGVQLIGIGILGEYIGRIYIETKQRPKYI LKRKGFKSEI
Uniprot No.

Target Background

Function

Involved in O-antigen modification. This enzyme catalyzes the transfer of a glucose residue from UDP-glucose to a lipid carrier.

Database Links

KEGG: vg:1262848

Protein Families
Glycosyltransferase 2 family, GtrB subfamily
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of Salmonella phage P22 gtrB?

Salmonella phage P22 gtrB functions as a bactoprenol glucosyltransferase that catalyzes the transfer of glucose molecules from UDP-glucose to undecaprenyl-pyrophosphate (UnDP) lipid carriers. This 933-bp open reading frame encodes a protein with a molecular mass of approximately 35,130 Da and an isoelectric point of 8.8. Structurally, gtrB contains two transmembrane domains primarily located in the latter two-thirds of the protein, suggesting both the amino and carboxy termini maintain cytoplasmic orientation . The protein's enzymatic activity represents the initial step in a coordinated process that ultimately results in the modification of bacterial O-antigens during glycosylation.

How does gtrB integrate into the broader gtrABC system?

The gtrB protein functions as part of a three-gene cassette (gtrABC) that collectively mediates O-antigen modification. Within this system, gtrB transfers glucose to the undecaprenyl-pyrophosphate lipid carrier, while gtrA functions as a flippase that translocates the UnDP-glucose complex across the inner membrane into the periplasmic space . The final step is performed by gtrC, which transfers the glucose molecule from the lipid carrier to a specific position on the growing O-antigen chain . This coordinated process occurs during O-antigen synthesis before attachment to the lipid A core. The complete pathway can be visualized as:

  • GtrB: Transfers glucose from UDP-glucose to UnDP (cytoplasmic side)

  • GtrA: Flips UnDP-glucose across the inner membrane

  • GtrC: Transfers glucose from UnDP to the O-antigen (periplasmic side)

How is expression of the gtrABC operon regulated?

Expression of the gtrABC operon, including gtrB, is regulated through a phase variation mechanism that is dependent on Dam methylation and OxyR. This regulatory system involves:

  • Two pairs of GATC sites upstream of the gtrA transcriptional start site

  • Three overlapping OxyR binding sites

  • Differential methylation patterns that determine promoter activity

When the downstream GATC pair is methylated, OxyR binding is prevented, allowing RNA polymerase access to the promoter and enabling transcription. Conversely, when the upstream GATC pair is methylated, OxyR binds to the downstream GATC sites, blocking RNA polymerase binding and preventing transcription . This creates a heterogeneous bacterial population with varying expression levels of the gtr genes, potentially serving as a virulence strategy to evade host immune responses.

What expression systems are most suitable for recombinant gtrB production?

For recombinant expression of gtrB, E. coli-based systems have proven effective, particularly when optimized for membrane protein expression. Based on research methodologies, successful expression typically involves:

Expression ParameterRecommended Approach
Host strainE. coli TOP10 cells or BL21(DE3) for high-yield production
VectorpBAD or pET series with appropriate promoter strength
InductionLow IPTG/arabinose concentration (0.1-0.5 mM)
Temperature25-30°C post-induction
MediaLB supplemented with 1% glucose
ExtractionMembrane fractionation with mild detergents

When designing expression constructs, incorporation of affinity tags (His6 or Strep-tag) at the C-terminus is generally preferred to avoid interference with the N-terminal membrane interaction domains. Temperature optimization is particularly critical due to the hydrophobic nature of the transmembrane regions .

What purification strategies yield active gtrB protein?

Purification of functional gtrB requires specialized approaches to maintain the native conformation of this membrane-associated protein:

  • Membrane isolation by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization with appropriate detergents (n-dodecyl β-D-maltoside or digitonin at 1-2%)

  • Affinity chromatography using immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography to remove aggregates

  • Detergent exchange to milder alternatives for activity assays

Activity retention can be monitored through in vitro transferase assays using radiolabeled UDP-glucose and synthetic lipid substrates. Enzyme stability is typically enhanced by maintaining the protein at concentrations above 1 mg/mL and including glycerol (10-15%) in storage buffers.

What structural features determine gtrB substrate specificity?

Analysis of gtrB protein sequence reveals important structural elements that contribute to its specific recognition of UDP-glucose and undecaprenyl-phosphate substrates:

Domain/MotifPositionProposed Function
Transmembrane domainsC-terminal regionMembrane anchoring and substrate access
DxD motifConserved across homologsCoordination of divalent cations for catalysis
Hydrophobic pocketMultiple regionsAccommodation of the lipid substrate
UDP-binding domainN-terminal regionRecognition of the nucleotide sugar donor

Comparative sequence analysis with homologous proteins from Shigella phages SfII, SfV, and SfX shows 86% sequence identity to a hypothetical 34.6-kDa protein (YFDH_ECOLI) associated with a defective prophage in the E. coli genome . This high degree of conservation suggests strong selective pressure on maintaining specific structural features required for function.

How does gtrB interact with other components of the serotype conversion machinery?

The functional relationship between gtrB and its partner proteins (gtrA and gtrC) involves complex membrane-associated interactions:

  • GtrB likely forms oligomeric complexes within the inner membrane

  • Direct protein-protein interactions with gtrA facilitate efficient transfer of the glucose-labeled lipid carrier

  • Co-localization with gtrC may create a functional "assembly line" for O-antigen modification

These interactions can be studied using techniques such as bacterial two-hybrid assays, co-immunoprecipitation, and fluorescence resonance energy transfer (FRET). Research has demonstrated that while gtrC(II) can function independently, most gtrC variants require the presence of functional gtrAB proteins to mediate O-antigen modification , highlighting the interdependence of these components.

How can recombinant gtrB be used to study bacterial lipopolysaccharide (LPS) modification?

Recombinant gtrB provides a valuable tool for investigating the mechanisms of O-antigen modification in various bacterial systems:

  • Heterologous expression in different Salmonella serovars to study O-antigen adaptability

  • Site-directed mutagenesis to identify critical residues for substrate recognition

  • In vitro reconstitution of complete gtrABC systems to study coordinated O-antigen modification

  • Development of inhibitors targeting glycosyltransferases as potential antimicrobial agents

Experimental approaches typically involve LPS extraction and analysis by SDS-PAGE, silver staining, and Western blotting with specific antibodies against modified epitopes. Mass spectrometry can provide detailed structural information about the modified O-antigens .

What role does gtrB-mediated O-antigen modification play in bacterial virulence?

The modification of O-antigens through the action of gtrB and its partner proteins has significant implications for bacterial pathogenesis:

  • Serotype conversion from 4,12 to 1,4,12 in Salmonella Typhimurium

  • Prevention of phage binding to lysogenized bacteria

  • Potential evasion of host immune recognition

  • Altered surface properties affecting adhesion and colonization

Research has demonstrated that lysogenization by P22 results in the addition of an α-linked glucosyl residue to the 6 position of galactose moieties in the LPS O-antigenic tetrameric repeat . This modification contributes to the phenomenon known as lysogenic conversion, which can protect bacteria from subsequent phage infection and potentially modulate interactions with host immune systems.

How conserved is gtrB across different bacteriophages and bacterial species?

Sequence analysis reveals remarkable conservation of gtrB across different phage and bacterial systems:

Organism/PhageProteinIdentity to P22 gtrBFunction
Shigella phage SfIIGtrBHigh similaritySerotype conversion
Shigella phage SfVGtrBHigh similaritySerotype conversion
Shigella phage SfXGtrBHigh similaritySerotype conversion
E. coli (prophage)YFDH_ECOLI86%Putative dolichol-phosphate mannosyl transferase
S. flexneriAcc# AAF09026.1 & AAC39272.187%Sugar transferases

Additional homologs have been identified in diverse organisms including Synechocystis, Bacillus, and Streptomyces , suggesting that this protein family represents an ancient and widely distributed mechanism for glycoconjugate modification. The high degree of sequence conservation indicates strong selective pressure to maintain specific functional domains.

Can gtrB from different systems functionally substitute for each other?

Cross-complementation studies have shown that GtrAB(IV) can functionally replace other GtrAB proteins of known function, indicating their conserved ability to bind and transfer glucose to a GtrC protein . This functional interchangeability supports the model that:

  • The basic enzymatic mechanism of glucose transfer to lipid carriers is conserved

  • Protein-protein interactions between GtrB and GtrA are maintained across different systems

  • The specificity of O-antigen modification is primarily determined by the GtrC component

These findings highlight the modular nature of the gtrABC system and suggest potential applications in synthetic biology for engineering novel glycosylation patterns.

What are the key unresolved questions regarding gtrB function and applications?

Despite significant advances in understanding gtrB, several important questions remain:

  • Detailed atomic structure of gtrB and its complexes with substrates

  • Kinetic mechanisms of glucose transfer and rate-limiting steps

  • Regulatory networks controlling gtrABC expression beyond phase variation

  • Potential for engineering gtrB to accept non-native substrates for glycoengineering applications

  • Role of gtrB-mediated modifications in bacterial persistence within hosts

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, microbial genetics, and immunology.

What emerging technologies might advance gtrB research?

Recent technological developments hold promise for deeper insights into gtrB function:

  • Cryo-electron microscopy for membrane protein structure determination

  • Native mass spectrometry for studying intact membrane protein complexes

  • CRISPR-Cas9 genome editing for precise manipulation of gtrABC systems

  • Single-molecule fluorescence techniques to observe gtrB activity in real-time

  • Synthetic biology approaches to create novel glycosylation pathways

These advanced methodologies could help resolve outstanding questions about the molecular mechanisms underlying gtrB function and potentially lead to applications in glycoengineering and antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.