Recombinant Salmonella phage P22 Bactoprenol-linked glucose translocase (gtrA)

Shipped with Ice Packs
In Stock

Description

Mechanistic Role in Serotype Conversion

GtrA functions as a bactoprenol-linked glucosyl translocase ("flippase") in the O-antigen modification pathway :

  1. Substrate binding: Transfers glucosylated undecaprenyl phosphate from the cytoplasmic to the periplasmic face of the inner membrane .

  2. Collaboration with GtrB and GtrC:

    • GtrB (bactoprenol glucosyltransferase) synthesizes the glucose-bactoprenol intermediate.

    • GtrC (glycosyltransferase) attaches glucose to galactose in the O-antigen .

  3. Biological impact:

    • Converts Salmonella serotype from 4,12 to 1,4,12 by adding α-linked glucose to LPS .

    • Confers resistance to P22 and related phages by altering LPS receptor accessibility .

3.1. Functional Studies

  • Membrane topology: TMHMM analysis confirmed GtrA’s four transmembrane domains, critical for flippase activity .

  • Genetic engineering: Cloning the gtrABC operon into Salmonella LT2 induced O1 antigen expression, validating its role in serotype conversion .

  • Phase variation control: Expression of gtrA is regulated by DNA methylation, linking environmental cues to antigenic diversity .

3.2. Homology and Evolution

  • GtrA shares structural and functional similarities with flippases in Shigella phages (e.g., SfV, SfX), despite belonging to divergent phage families (Podoviridae, Inoviridae) .

  • Phylogenetic analysis suggests horizontal gene transfer between Salmonella and Shigella prophages, driven by selective pressure for LPS modification .

Industrial and Biomedical Relevance

  • Diagnostics: Recombinant GtrA aids in studying O-antigen glucosylation mechanisms for serotyping Salmonella strains .

  • Phage therapy: Understanding GtrA’s role in LPS modification informs strategies to circumvent phage resistance in pathogenic Salmonella .

  • Protein engineering: The His-tagged recombinant form (expressed in E. coli) is utilized for structural studies and inhibitor screening .

Challenges and Future Directions

  • Functional redundancy: Coexistence of multiple gtr operons in Salmonella complicates targeted interventions .

  • Structural resolution: The absence of a crystal structure for GtrA limits mechanistic insights into substrate translocation .

  • Carrier state dynamics: Phage P22’s ability to maintain a lysogenic "carrier state" in Salmonella highlights unresolved questions about GtrA regulation under stress .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gtrA; Bactoprenol-linked glucose translocase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella phage P22 (Bacteriophage P22)
Target Names
gtrA
Target Protein Sequence
MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVIAVSFSFYANARFTFNA TTTTLRYMMYVGFMGTLSAVVGWMADQCSLPPLITLITFSAISLVCGFIYSRFIVFRDIR
Uniprot No.

Target Background

Function
Recombinant Salmonella phage P22 Bactoprenol-linked glucose translocase (GtrA) is involved in O-antigen modification and the translocation of bactoprenol-linked glucose across the cytoplasmic membrane.
Database Links

KEGG: vg:1262849

Protein Families
GtrA family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the Salmonella phage P22 gtrA and what is its primary function?

The gtrA protein from Salmonella phage P22 is a bactoprenol-linked glucose translocase that functions as part of the serotype conversion system in lysogenic Salmonella. It is one component of the gtrABC cassette located adjacent to the phage attachment site (attP) in the P22 genome. The primary function of gtrA is to participate in the modification of the lipopolysaccharide O-antigen through the addition of α-linked glucosyl residues to the 6 position of galactose moieties in the LPS O-antigenic tetrameric repeat. This modification changes the bacterial serotype from 4,12 to 1,4,12, which prevents binding of P22 and other Typhimurium phages, a phenomenon known as lysogenic conversion .

How does the gtrA gene relate to other components in the serotype conversion cassette?

The gtrA gene works in conjunction with gtrB and gtrC as part of the serotype-converting cassette in phage P22. Sequence analysis has revealed that gtrA and gtrB from P22 show considerable sequence relatedness to the corresponding genes in Shigella phages SfII, SfV, and SfX, suggesting evolutionary conservation of these functional modules across different phage species. Within the cassette, gtrA likely functions in flipping the sugar precursor across the membrane, while gtrB functions as a glycosyl transferase, and gtrC provides serotype specificity for the modification .

What is the genomic context of the gtrA gene in Salmonella phage P22?

The gtrA gene is located in the serotype conversion region of the P22 genome, which spans 41,724 bp with a GC content of 47.1%. The gene is positioned adjacent to the phage attachment site (attP) and is part of the gtrABC cassette. This genomic arrangement is strategically important as it ensures that the serotype conversion genes are maintained in lysogenized bacteria, providing protection against superinfection by homoimmune phages .

How does the timing of P22 excision relate to lateral transduction and gtrA expression?

The Salmonella phage P22 has evolved a unique replication-packaging-excision (RPE) program rather than following the previously assumed early excision followed by DNA replication and packaging (ERP) program. This delay in excision until just before it would become detrimental to phage production allows P22 to engage in lateral transduction. This process likely enhances the transfer of host genes, including potentially the gtrABC cassette, powering the evolution of its host through gene transfer. The expression of gtrA and other serotype conversion genes would be maintained in lysogenized bacteria, contributing to the bacterial defense against superinfection while facilitating phage-mediated horizontal gene transfer .

What structural features of gtrA enable its function in membrane transport?

While the search results don't provide specific structural information about gtrA, related translocases typically function as membrane proteins with multiple transmembrane domains. The gtrA protein likely facilitates the flipping of bactoprenol-linked glucose across the cytoplasmic membrane, allowing the sugar to be accessible for modification of the O-antigen by gtrC. Future structural studies using techniques such as X-ray crystallography or cryo-electron microscopy would be valuable for elucidating the precise structural features that enable gtrA's function in membrane transport .

What are the optimal conditions for expressing recombinant P22 gtrA in research settings?

For optimal expression of recombinant P22 gtrA, researchers should consider the following methodology:

  • Expression system selection: E. coli BL21(DE3) or similar strains are recommended for initial expression trials due to their reduced protease activity and compatibility with T7 promoter-based expression systems.

  • Vector design: Incorporate affinity tags (His6, GST, or MBP) to facilitate purification, with cleavage sites for tag removal if necessary for functional studies.

  • Expression conditions: Test multiple induction temperatures (18°C, 25°C, 37°C) and IPTG concentrations (0.1-1.0 mM) to optimize for soluble protein expression.

  • Membrane protein considerations: As gtrA likely functions as a membrane protein, consider using specialized membrane protein expression systems such as C41(DE3) or C43(DE3) E. coli strains.

  • Codon optimization: Optimize codons for the expression host to improve translation efficiency.

The expression should be validated by Western blotting with antibodies against the affinity tag or the gtrA protein itself .

How can functional assays be designed to assess gtrA activity in vitro?

Functional assays for gtrA translocase activity can be designed using the following methodological approaches:

  • Reconstitution in liposomes: Purified gtrA can be reconstituted into liposomes containing fluorescently labeled glucose derivatives to monitor transport across the membrane.

  • Bactoprenol-linked substrate preparation: Synthesize or isolate bactoprenol-linked glucose as the substrate for gtrA.

  • Transport assay design: Measure the flipping of bactoprenol-linked glucose from the inner to the outer leaflet of the membrane using techniques such as:

    • Fluorescence quenching assays

    • Radiolabeled substrate tracking

    • Mass spectrometry-based quantification of substrate translocation

  • Coupled enzyme assays: Design assays that couple gtrA activity with subsequent steps in the pathway (gtrB and gtrC) to monitor the complete modification process.

Control experiments should include known inhibitors of translocases and variants of gtrA with mutations in predicted functional domains .

What approaches can be used to study the interaction between gtrA, gtrB, and gtrC in the serotype conversion process?

The interaction between the components of the gtrABC cassette can be studied using the following methodological approaches:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of gtrA, gtrB, and gtrC and use antibodies against one component to precipitate the complex and detect interacting partners.

  • Bacterial two-hybrid assays: Adapt bacterial two-hybrid systems to detect membrane protein interactions between gtrA, gtrB, and gtrC.

  • FRET-based interaction assays: Label gtrA, gtrB, and gtrC with appropriate fluorophore pairs and measure Förster resonance energy transfer to detect proximity and interaction.

  • Cross-linking studies: Use chemical cross-linkers to capture transient interactions between the gtr proteins, followed by mass spectrometry analysis.

  • Functional complementation: Test whether defects in one component can be complemented by wild-type versions of the other components to understand functional interdependence.

These approaches should be combined with mutational analysis to identify specific residues or domains involved in the interactions between gtrA, gtrB, and gtrC .

How should researchers interpret experimental data comparing gtrA from different phage species?

When analyzing comparative data on gtrA from different phage species, researchers should:

  • Sequence alignment analysis: Use multiple sequence alignment tools (MUSCLE, Clustal Omega) to identify:

    • Conserved residues likely essential for function

    • Variable regions potentially involved in host-specific adaptations

    • Transmembrane domain conservation

  • Phylogenetic analysis interpretation: Construct and interpret phylogenetic trees to:

    • Identify evolutionary relationships between gtrA proteins

    • Correlate gtrA evolution with host range and specificity

    • Detect potential horizontal gene transfer events

  • Structure-function correlation: Map sequence variations onto predicted structural models to understand:

    • Impact on substrate specificity

    • Membrane interaction differences

    • Potential functional adaptations

  • Statistical approaches: Apply appropriate statistical methods for:

    • Distinguishing significant functional differences from experimental variation

    • Correlating sequence divergence with functional parameters

    • Identifying coevolving residues within the protein

Table 1: Comparative analysis of key features in gtrA proteins from different phages

Phage SourceLength (aa)% Identity to P22 gtrAHost SpeciesKey Functional DomainsNotable Sequence Features
P22~120100%Salmonella TyphimuriumTransmembrane domains, substrate binding siteReference sequence
SfII~120~70-75%*Shigella flexneriConserved transmembrane topologyVariations in putative substrate interaction region
SfV~120~70-75%*Shigella flexneriConserved catalytic residuesHost-specific adaptation in N-terminal region
SfX~120~70-75%*Shigella flexneriConserved membrane association domainsAltered C-terminal signaling domain

*Estimated based on reported "considerable sequence relatedness"

What controls should be included when analyzing the functional impact of gtrA mutations?

When designing experiments to analyze the functional impact of gtrA mutations, researchers should include the following controls:

  • Positive controls:

    • Wild-type gtrA expression construct

    • Known functional homologs from related phages

    • Complete gtrABC cassette to confirm system functionality

  • Negative controls:

    • Empty vector constructs

    • Catalytically inactive mutants (based on conserved residues)

    • Truncated gtrA lacking essential domains

  • Experimental validation controls:

    • Expression level verification (qPCR, Western blot)

    • Protein localization confirmation (membrane fraction analysis)

    • Stability assessment (pulse-chase analysis)

  • System-specific controls:

    • Host cells lacking endogenous gtr genes

    • Complementation with heterologous gtrA proteins

    • Competition assays with unlabeled substrates

  • Data analysis controls:

    • Technical replicates (minimum of 3)

    • Biological replicates (minimum of 3 independent transformations or expressions)

    • Dose-response curves for quantitative measurements

These controls will ensure robust interpretation of mutational effects and distinguish between direct functional impacts versus indirect effects on protein stability or localization .

How can researchers distinguish between the effects of gtrA and other serotype conversion factors in bacterial phenotype changes?

To differentiate between the specific effects of gtrA and other serotype conversion factors, researchers can employ these methodological approaches:

  • Gene-specific deletions and complementation:

    • Create individual deletions of gtrA, gtrB, and gtrC

    • Complement each deletion with the corresponding wild-type gene

    • Create combination deletions and complementations

    • Analyze the resulting phenotypes for each genetic background

  • Biochemical pathway dissection:

    • Measure accumulation of pathway intermediates in each mutant

    • Use specific inhibitors for each step in the serotype conversion process

    • Monitor metabolic flux through the pathway using labeled precursors

  • Temporal expression analysis:

    • Use inducible promoters to control the timing of expression for each component

    • Monitor serotype conversion process in real-time using appropriate reporters

    • Determine rate-limiting steps through pulse-chase experiments

  • Heterologous expression systems:

    • Express individual components in non-native hosts lacking related pathways

    • Reconstruct the complete pathway by sequential addition of components

    • Test cross-complementation with homologs from other phages

  • Structural biology approaches:

    • Determine structural changes in LPS with each component expressed individually

    • Use mass spectrometry to characterize modifications at each step

    • Compare modification patterns between different genetic backgrounds

What are the potential applications of gtrA in glycoengineering and synthetic biology?

The Salmonella phage P22 gtrA translocase has several potential applications in glycoengineering and synthetic biology:

  • Designer glycan synthesis:

    • Engineering gtrA variants with altered substrate specificity could enable the production of novel glycosylated molecules

    • Creating synthetic pathways for the production of rare or modified glycans

    • Developing orthogonal glycosylation systems for specific labeling of proteins or cellular structures

  • Bacterial vaccine development:

    • Using gtrA-mediated O-antigen modification to create attenuated bacterial strains

    • Engineering controlled expression of serotype conversion to create multivalent vaccine candidates

    • Developing glycoconjugate vaccines with specific modifications

  • Biocontainment strategies:

    • Engineering dependence on gtrA-mediated modifications for bacterial survival

    • Creating synthetic auxotrophy based on glycosylation requirements

    • Developing phage resistance mechanisms based on controlled expression of gtrA

  • Biosensors and diagnostics:

    • Adapting gtrA-dependent pathways to detect specific environmental signals

    • Creating reporter systems based on serotype conversion

    • Developing diagnostic tools for bacterial serotype identification

  • Evolutionary and ecological studies:

    • Using gtrA as a model for studying horizontal gene transfer

    • Investigating the role of serotype conversion in bacterial adaptation

    • Exploring phage-host coevolution through the lens of serotype modification

These applications build on the fundamental understanding of gtrA's role in serotype conversion while extending its utility to diverse biotechnological contexts .

How might research on gtrA contribute to understanding phage-host coevolution?

Research on the Salmonella phage P22 gtrA can provide valuable insights into phage-host coevolution through several avenues:

  • Molecular arms race dynamics:

    • The evolution of gtrA represents adaptation to overcome bacterial defenses

    • Changes in substrate specificity reflect coevolution with bacterial LPS modifications

    • The rate of molecular evolution in gtrA can serve as a marker for selection pressure

  • Horizontal gene transfer mechanisms:

    • The role of gtrA in lateral transduction highlights a mechanism for genetic exchange

    • The presence of similar gtrA genes across diverse phages suggests horizontal acquisition

    • Understanding how phages acquire and adapt glycosylation machinery from hosts or other phages

  • Lysogenic conversion as an evolutionary strategy:

    • The benefits of serotype conversion for both phage (preventing superinfection) and host (altered antigenicity)

    • The balance between vertical transmission (lysogeny) and horizontal spread (lytic cycle)

    • The selection for maintenance of functional gtrA in prophage genomes

  • Modular evolution of phage genomes:

    • The gtrABC cassette as a functional module that can be exchanged between phages

    • The integration of host-derived genes into phage modification systems

    • The recombination and reassortment of functional modules in phage evolution

  • Ecological implications:

    • The role of serotype conversion in structuring bacterial populations

    • The impact of gtrA-mediated modifications on bacterial fitness in different environments

    • The contribution of phage-mediated serotype conversion to bacterial diversification

This research connects molecular mechanisms to evolutionary processes, providing a comprehensive view of phage-host interactions through time .

What are common challenges in expressing and purifying functional recombinant gtrA?

Researchers working with recombinant gtrA may encounter several challenges due to its nature as a membrane-associated protein. Common issues and their methodological solutions include:

  • Protein aggregation and inclusion body formation:

    • Lower expression temperature (16-20°C)

    • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Optimize inducer concentration (typically lower IPTG concentrations)

    • Consider auto-induction media for gradual protein expression

  • Membrane protein solubilization:

    • Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations

    • Test mild solubilization conditions to maintain native conformation

    • Consider amphipols or nanodiscs for maintaining functional state

    • Use lipid-like detergents for membrane protein extraction

  • Low expression levels:

    • Optimize codon usage for expression host

    • Use strong but controllable promoters (T7, tac)

    • Consider specialized expression strains (C41/C43 for membrane proteins)

    • Evaluate different signal sequences for proper membrane targeting

  • Protein instability:

    • Include protease inhibitors throughout purification

    • Maintain appropriate buffer conditions (pH, salt concentration)

    • Add stabilizing agents (glycerol, specific lipids)

    • Perform purification at 4°C to minimize degradation

  • Activity loss during purification:

    • Develop rapid purification protocols to minimize time

    • Include substrate analogs or stabilizing ligands during purification

    • Reconstituate purified protein into liposomes with native-like lipid composition

    • Validate function at each purification step with activity assays

These methodological approaches can help overcome the challenges associated with working with this membrane-associated translocase .

How can researchers address data inconsistencies in serotype conversion studies?

When confronting data inconsistencies in serotype conversion studies involving gtrA, researchers should implement the following methodological approaches:

  • Standardize experimental conditions:

    • Define precise growth conditions (media, temperature, growth phase)

    • Establish consistent induction protocols for gene expression

    • Standardize assay conditions across experiments

    • Create detailed standard operating procedures (SOPs)

  • Address biological variability:

    • Increase biological replicates (minimum n=3, preferably n≥5)

    • Use multiple independent bacterial clones

    • Account for phase variation or spontaneous mutations

    • Consider population heterogeneity in analyses

  • Improve detection methods:

    • Employ multiple techniques to measure serotype conversion

    • Use quantitative rather than qualitative assessments when possible

    • Establish clear positive and negative controls

    • Develop internal standards for normalization

  • Statistical approaches:

    • Apply appropriate statistical tests based on data distribution

    • Use power analysis to determine adequate sample size

    • Implement multivariate analysis to identify confounding factors

    • Consider Bayesian approaches for complex data integration

  • Systematic troubleshooting:

    • Isolate variables by changing one factor at a time

    • Test reagent quality and specificity regularly

    • Validate key results with complementary methods

    • Document all experimental parameters meticulously

Table 2: Troubleshooting matrix for inconsistent serotype conversion results

ObservationPossible CausesRecommended ActionsValidation Methods
No serotype conversionInactive gtrAVerify protein expression and localizationWestern blot, membrane fraction analysis
Missing cofactorsSupplement with predicted cofactorsMetabolomics analysis
Incompatible host backgroundTest in multiple host strainsComplementation studies
Partial conversionHeterogeneous expressionOptimize induction conditionsFlow cytometry analysis
Limiting substratesSupplement growth mediumMass spectrometry analysis
Competing pathwaysGenerate knockout strainsMetabolic flux analysis
Variable resultsPhase variationUse clonal populationsSequence verification
Environmental fluctuationsControl growth conditions strictlyContinuous monitoring
Technical variationStandardize protocolsSpike-in controls

This systematic approach helps identify sources of inconsistency and establish reliable experimental paradigms .

What are the most promising future directions for gtrA research in phage biology?

The study of Salmonella phage P22 gtrA represents a fertile ground for future research with several promising directions:

  • Structural biology perspectives:

    • Determining the high-resolution structure of gtrA to understand its membrane topology and substrate binding sites

    • Investigating conformational changes during the translocation cycle

    • Exploring the structural basis for interactions with gtrB and gtrC

  • Systems biology approaches:

    • Integrating gtrA function into models of phage infection dynamics

    • Understanding the regulatory networks controlling gtrA expression

    • Mapping the metabolic impact of serotype conversion on host physiology

  • Evolutionary perspectives:

    • Tracing the evolutionary history of gtrA across diverse phage lineages

    • Identifying selection pressures driving gtrA diversification

    • Understanding the acquisition and maintenance of serotype conversion genes

  • Synthetic biology applications:

    • Engineering gtrA variants with novel substrate specificities

    • Developing controlled serotype switching systems

    • Creating synthetic glycosylation pathways based on gtrA function

  • Therapeutic potential:

    • Exploring gtrA as a target for anti-phage strategies

    • Developing inhibitors of serotype conversion to prevent lysogenic conversion

    • Using engineered gtrA systems for targeted modification of bacterial pathogens

These future directions build on the foundational understanding of gtrA function while extending its relevance to broader questions in phage biology, bacterial physiology, and biotechnological applications .

How does understanding gtrA function contribute to broader glycobiology research?

Research on Salmonella phage P22 gtrA extends beyond phage biology to inform broader glycobiology research in several key ways:

  • Membrane translocation mechanisms:

    • gtrA provides a model system for understanding how glycan precursors are transported across membranes

    • Comparison with eukaryotic flippases reveals convergent solutions to similar biological challenges

    • Insights into the energetics and kinetics of glycan translocation processes

  • Glycosylation pathway organization:

    • The functional coupling between gtrA, gtrB, and gtrC illustrates principles of glycosylation pathway organization

    • Understanding how substrate channeling occurs between sequential enzymatic steps

    • Insights into the spatial organization of membrane-associated glycosylation machinery

  • Glycan diversity and evolution:

    • Phage-mediated serotype conversion represents a mechanism for generating glycan diversity

    • The evolutionary pressures driving glycan modification provide insights into glycan-protein recognition

    • Understanding the functional consequences of specific glycan modifications

  • Prokaryotic glycobiology foundations:

    • gtrA research contributes to the understanding of prokaryotic glycobiology, which has historically received less attention than eukaryotic systems

    • Comparison with eukaryotic systems reveals both shared principles and unique aspects of bacterial glycobiology

    • Insights into the minimal requirements for functional glycosylation pathways

  • Analytical approaches in glycobiology:

    • Methods developed for studying gtrA-mediated modifications can be applied to other glycobiology questions

    • Techniques for tracking glycan translocation across membranes have broad applicability

    • Approaches for detecting and characterizing specific glycan modifications can inform glycomics research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.