Recombinant Salmonella phage P22 Superinfection exclusion protein A (sieA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sieA; Superinfection exclusion protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella phage P22 (Bacteriophage P22)
Target Names
sieA
Target Protein Sequence
MSDSMSYAVLVAATLFLGIGLQIAWLFFSNFIKRKRLESRISEVSIAIGKNAKNPENEAY VLNYLKEKFSPERFENRITDALGLIISVIHIPLSLLITVWYFAMIAGRIFGFMNIEPVVL WVPMILQLLLSIAIFIFSVFIKIVFGRYPGEANGFNKEFIKTIK
Uniprot No.

Target Background

Function
The Salmonella phage P22 superinfection exclusion protein A (SieA) likely inhibits the translocation of phage DNA across the inner membrane into the cytoplasm. This mechanism prevents superinfection by phages of the same family and other phage DNA.
Database Links

KEGG: vg:1262788

Subcellular Location
Host cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella phage P22 Superinfection exclusion protein A (SieA)?

Salmonella phage P22 SieA is one of four prophage-encoded systems that prevent superinfection in Salmonella lysogens. SieA is an inner membrane protein that specifically blocks DNA injection by P22 and closely related phages, but has no effect on other tailed phage types. It functions by interfering with the assembly or function of the DNA delivery conduit formed by phage ejection proteins. The SieA protein is both necessary and sufficient for superinfection exclusion in this system, operating at an early stage of infection to prevent phage DNA from entering the bacterial cell .

How does SieA protein differ from other superinfection exclusion systems in P22?

Salmonella phage P22 utilizes four distinct superinfection exclusion mechanisms: (i) the C2 repressor protein that prevents lytic gene expression in homo-immune phages; (ii) the GtrABC proteins that modify the bacterial O-antigen surface polysaccharide to block phage adsorption; (iii) the SieA protein that blocks DNA injection; and (iv) the SieB system that terminates macromolecular synthesis midway through the lytic cycle of superinfecting phages. Unlike the other systems, SieA specifically targets the DNA injection process by interfering with the phage's ejection proteins gp16 and gp20, which are essential components of the DNA delivery conduit .

What is the cellular location and functional mechanism of SieA protein?

SieA functions as an inner membrane protein that specifically interferes with the periplasmic gp20 and membrane-bound gp16 DNA delivery conduit of P22 and related phages. When a SieA-expressing cell is infected by P22, the phage can still adsorb to the cell surface and the tail can penetrate the outer membrane, but the injection of DNA is blocked at the inner membrane step. This mechanism is highly specific, as it only affects P22-like phages and not other phage types, suggesting a direct interaction between SieA and components of the P22 DNA injection machinery .

How can recombinant SieA protein be expressed in laboratory settings?

To express recombinant SieA protein, researchers have successfully utilized chromosomal insertion methods. Based on experimental evidence, the following approach has proven effective:

  • Insert the sieA gene into the bacterial chromosome using recombineering techniques

  • Include the putative promoter sequence (P) with approximately 85 bp upstream of the sieA start codon and 22 bp downstream of the stop codon

  • Position the gene in the same transcriptional orientation as surrounding genes (e.g., replacing galK while maintaining orientation with the gal operon)

This approach ensures stable expression of SieA without significantly affecting cell growth. For example, in S. enterica LT2 strain UB-2520, the inserted sieA gene showed robust expression sufficient to lower P22 plaque-forming ability by at least seven orders of magnitude .

What methods are most effective for studying SieA-mediated superinfection exclusion?

Several complementary approaches have proven effective for studying SieA-mediated superinfection exclusion:

  • Plaque assays: Comparing plaque formation efficiency between sieA+ and sieA- hosts allows quantification of exclusion strength. This method revealed that a single chromosomal copy of sieA can reduce P22 plaque formation by at least 10^7-fold.

  • Liquid culture infection: Monitoring cell lysis in liquid culture at controlled multiplicity of infection (MOI) provides information about exclusion dynamics.

  • Mutant isolation: Isolation of phage mutants that overcome SieA exclusion (using methods such as nitrosoguanidine mutagenesis) helps identify the phage targets of SieA.

  • Whole-genome sequencing: Sequencing escape mutants identifies the genetic changes required to overcome SieA exclusion .

How can researchers assess SieA function across different bacterial hosts?

To evaluate SieA function in different bacterial hosts, researchers can employ the following methodological approach:

  • Insert the P22 sieA gene into the chromosomes of target bacterial species (e.g., E. coli)

  • Maintain the native regulatory elements to ensure proper expression

  • Challenge the engineered strains with phages specific to that host

  • Quantify exclusion efficacy by comparing plaque formation between sieA+ and sieA- strains

This approach has demonstrated that P22 SieA functions in E. coli, excluding phage CUS-3 with high efficiency (≤10^-8 plating efficiency) while being less effective against phage HK620 (0.33 plating efficiency). Such cross-species functionality tests provide insights into the molecular specificity of SieA-mediated exclusion .

Bacterial HostPhagePlating Efficiency (No SieA)Plating Efficiency (P22 SieA+)
S. enterica (UB-0002)P22 "WT"1<10^-8
E. coli 2158HK620 WT10.33
E. coli EV36CUS-3 WT1<10^-8

Table 1: Comparative plating efficiencies of different phages on hosts with and without P22 SieA expression .

What mutations allow phages to overcome SieA-mediated exclusion?

Phages can overcome SieA-mediated exclusion through specific mutations in their ejection proteins. Research using nitrosoguanidine mutagenesis identified phage mutants that escape SieA exclusion at a frequency of approximately 1 in 10^8 phages. Whole-genome sequencing of eight independent escape mutants revealed that all contained mutations in the ejection protein-encoding genes 16 and 20:

  • All eight mutants carried the gp16 P546S substitution

  • Five mutants additionally contained the gp20 G350D substitution

  • The remaining three mutants carried alternative gp20 mutations: T338I, T41I, or A348T

These mutations generally affect the C-terminal regions of the gp16 and gp20 ejection proteins. Notably, multiple amino acid changes (typically three) are required to achieve nearly full resistance to SieA exclusion, suggesting a complex interaction between SieA and the phage injection machinery .

What is the evolutionary relationship between different SieA proteins in phage populations?

Evolutionary analysis of SieA proteins reveals significant divergence across phage populations. The research indicates:

  • There are at least three sequence types of extant phage-encoded SieA proteins

  • These SieA variants share less than 30% sequence identity with one another

  • Despite this low sequence conservation, comparison of different SieA types showed no differences in phage target specificity

This pattern suggests that SieA proteins have undergone significant sequence diversification while maintaining functional conservation. The convergent evolution toward the same phage targets despite sequence divergence indicates strong selective pressure for the superinfection exclusion function. This evolutionary pattern is consistent with an arms race scenario between phages and their bacterial hosts carrying prophage-encoded exclusion systems .

How can researchers optimize recombinant SieA expression for functional studies?

Optimizing recombinant SieA expression requires attention to several critical factors:

  • Translation initiation site accessibility: As demonstrated in research on recombinant protein production, the accessibility of translation initiation sites significantly affects expression success. For membrane proteins like SieA, ensuring optimal mRNA secondary structure at the initiation region can dramatically improve expression levels .

  • Synonymous codon optimization: Using the first nine codons with synonymous substitutions can significantly impact expression levels without altering the protein sequence. Tools like TIsigner, which uses simulated annealing to modify these codons, can help optimize expression .

  • Host strain selection: Choose bacterial host strains compatible with membrane protein expression. For SieA, evidence suggests it functions across species boundaries (e.g., in both Salmonella and E. coli), providing flexibility in host selection .

  • Expression control: Careful control of expression levels is important, as overexpression of membrane proteins can be toxic. Utilizing the native promoter with appropriate upstream regulatory elements can help achieve functional expression levels without cellular stress .

What approaches are most effective for studying SieA membrane interactions?

To effectively study SieA membrane interactions, researchers should consider these methodological approaches:

  • Ion flux measurements: Potassium-selective electrodes can be used to measure ion release from infected cells, providing insights into membrane integrity during phage infection in the presence of SieA. As indicated in the literature, P22 causes minimal ion release from SieA-expressing strains .

  • Membrane protein localization studies: Techniques such as fluorescent protein tagging or immunofluorescence microscopy can help determine the precise subcellular localization of SieA within the inner membrane.

  • Protein-protein interaction assays: Methods like bacterial two-hybrid systems or co-immunoprecipitation can identify specific interactions between SieA and other membrane components or phage proteins.

  • Membrane fractionation: Separation of inner and outer membranes followed by detection of SieA provides confirmation of its membrane localization and abundance under different conditions.

These approaches, used in combination, can provide comprehensive insights into how SieA associates with the bacterial membrane and interferes with phage DNA injection machinery .

How can researchers design experiments to identify novel targets of SieA protein?

Designing experiments to identify novel targets of SieA requires a multi-faceted approach:

  • Genetic screening for escape mutants: Mutagenize phages and select for those that can overcome SieA exclusion. Whole-genome sequencing of these mutants can identify potential target proteins, as demonstrated by the identification of gp16 and gp20 as SieA targets .

  • Phage hybrid construction: Create hybrid phages with ejection proteins from different phages to test which components confer sensitivity or resistance to SieA exclusion. This approach provided evidence that P22-Fels-1 hybrids could escape SieA exclusion .

  • Cross-species functional testing: Test SieA function against diverse phages that infect different host bacteria to determine the range of SieA targets. The differential exclusion of CUS-3 and HK620 phages in E. coli hosts expressing P22 SieA illustrates this approach .

  • Comparative genomics: Analyze phages that are differentially affected by SieA to identify common structural or sequence features that might determine sensitivity to exclusion.

By combining these approaches, researchers can systematically identify the spectrum of phage components targeted by SieA and gain insights into the molecular mechanisms of superinfection exclusion.

What techniques could advance our understanding of SieA structural biology?

Advanced structural biology techniques offer promising avenues for understanding SieA function:

  • Cryo-electron microscopy: For visualizing the interaction between SieA and phage components during the injection process

  • X-ray crystallography or NMR spectroscopy: To determine the three-dimensional structure of SieA and identify functional domains

  • Molecular dynamics simulations: To model how SieA interacts with bacterial membranes and phage injection machinery

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions of SieA involved in protein-protein interactions

These approaches would help elucidate the precise structural basis for SieA's ability to block DNA injection in a phage-specific manner .

How might SieA research inform the development of phage resistance strategies?

Research on SieA has significant implications for developing novel phage resistance strategies:

  • Engineered superinfection exclusion: The demonstrated cross-species functionality of SieA suggests it could be used to engineer phage resistance in various bacteria of interest.

  • Multi-layer defense systems: Understanding how SieA works alongside other exclusion mechanisms in P22 could inform the design of multi-component defense systems.

  • Targeted modification of phage injection machinery: Knowledge of SieA targets could enable the rational design of modified phages with enhanced ability to overcome bacterial defense mechanisms.

  • Evolutionary insights: Understanding the co-evolution of SieA and phage escape mechanisms provides valuable information about the dynamics of phage-host interactions that could inform resistance strategies .

What are the potential applications of SieA in synthetic biology?

SieA offers several promising applications in synthetic biology:

  • Modular exclusion systems: SieA could be incorporated into synthetic genetic circuits as a modular component to control phage susceptibility in bacterial populations.

  • Selective phage containment: Given its specificity for certain phage types, SieA could be used to selectively eliminate specific phages while allowing others to propagate in mixed cultures.

  • Biosensor development: Modified SieA proteins could potentially be developed as biosensors for detecting specific phage types or for studying membrane dynamics.

  • Evolution studies: The SieA system provides a valuable model for studying evolutionary arms races in synthetic microbial communities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.