Recombinant Enterobacteria phage PRD1 Infectivity protein P11 (XI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
XI; Infectivity protein P11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Enterobacteria phage PRD1 (Bacteriophage PRD1)
Target Names
XI
Target Protein Sequence
MEKVKAWLIKYKWWIVAAIGGLAAFLLLKNRGGGSGGGGEYMVGSGPVYQQAGSGAVDNT MALAALQANTQLSAQNAQLQAQMDASRLQLETQLNIETLAADNAHYSTQSQLQLGMAQVD LSKYLGDLQSTTSTALAGMQSDTAKYQSNIQLQAENIRANTSLAEIDAQKYIVGKQADIA KYQAKTERRGQDYGFALGLLNFGGKFF
Uniprot No.

Target Background

Function

Recombinant Enterobacteria phage PRD1 Infectivity protein P11 (XI) is a component of the phage ejection machinery. It functions as a pilot protein in the formation of the tube that delivers the genome into the target cell. P11 is likely involved in penetrating the bacterial outer membrane and making the peptidoglycan layer accessible to the viral transglycosylase. Its presence is essential for viral infectivity.

Database Links

KEGG: vg:1260930

Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is Enterobacteria phage PRD1 and what role does protein P11 play in its structure?

Enterobacteria phage PRD1 is a complex, membrane-containing, double-stranded DNA bacteriophage that shares significant structural similarities with adenoviruses. It belongs to the Tectiviridae family and infects Gram-negative bacteria such as Escherichia coli and Salmonella enterica. PRD1 possesses an outer icosahedral protein capsid (70 nm in diameter), an internal lipid bilayer, and a linear dsDNA genome with 5′ covalently linked replication priming proteins .

Protein P11 is one of several proteins located at a unique vertex of the PRD1 virus structure. This vertex differs from the other vertices in that it contains proteins specifically responsible for DNA translocation (P6, P11, and P20) while lacking the receptor-binding proteins (P2 and P5) found at the other 11 binding vertices . P11 is therefore crucial to the DNA packaging and delivery mechanisms of the virus, constituting part of the specialized machinery for genetic material transfer during infection .

How does the unique vertex containing protein P11 differ from other vertices in bacteriophage PRD1?

The PRD1 bacteriophage possesses 12 vertices due to its icosahedral structure, but these vertices are not identical. Experimental evidence has revealed two distinct types of vertices:

  • Binding vertices (11 of 12): These contain proteins P2 and P5, which are involved in receptor recognition and binding. P2 is a monomeric receptor-binding protein, while P5 forms a soluble trimer and functions as a spike protein .

  • Unique vertex (1 of 12): This specialized vertex contains proteins P6, P11, and P20, which are responsible for DNA translocation. Notably, this vertex lacks the P2 and P5 proteins found at the binding vertices .

The unique vertex extends to the virus's internal membrane through integral membrane proteins P20 and P22, creating a continuous passage from the outer capsid to the inner compartment of the virus. This structural arrangement is crucial for the packaging of the viral genome and its subsequent delivery into host cells during infection .

What experimental evidence supports the function of P11 in DNA translocation?

The function of P11 in DNA translocation is supported by several lines of experimental evidence:

  • Labeling experiments with monoclonal antibodies: These experiments against vertex proteins have demonstrated the existence of different types of vertices in PRD1, with the unique vertex containing P11 and lacking the receptor-binding proteins found at other vertices .

  • Mutant virus studies: Research on PRD1 mutants deficient in various proteins has helped elucidate the roles of vertex components. For instance, viruses lacking pentameric vertex protein P31 also lack proteins P2 and P5, indicating interdependencies in the vertex structure .

  • Membrane connection studies: Investigations have shown that the unique vertex containing P11 extends to the virus internal membrane via integral membrane proteins P20 and P22. These small membrane proteins are necessary for binding the putative packaging ATPase P9 to the virus particle via another capsid protein, P6 .

These findings collectively suggest that P11, as part of the unique vertex complex, plays a critical role in the mechanism by which PRD1 packages and delivers its DNA genome.

What experimental design considerations are crucial when studying the interactions between P11 and other proteins at the unique vertex?

When investigating the interactions between P11 and other proteins at the unique vertex of PRD1, researchers must consider several critical experimental design factors:

  • Protein purification strategy: The membrane-associated nature of some vertex components requires careful selection of detergents and purification conditions to maintain protein structure and interaction capabilities.

  • Symmetry mismatch resolution: Since the unique vertex represents an asymmetric feature in an otherwise highly symmetric icosahedral structure, specialized approaches are needed to resolve its structure without it being averaged out during analysis .

  • Mutant construction and analysis: Strategic construction of virus mutants with deletions or modifications of specific proteins helps evaluate their interdependencies. For example:

    Mutant TypeProteins AffectedObserved EffectsResearch Applications
    P31-deficientLacks P2 and P5Altered vertex structureStudies vertex protein dependencies
    P5-deficientLacks P2Altered host bindingExamines spike complex assembly
    P11-modifiedVaries based on modificationChanges in DNA packaging efficiencyInvestigates P11 functional domains
  • Visualization techniques: Cryo-electron microscopy with targeted image reconstruction methods that don't rely on icosahedral averaging is essential for visualizing asymmetric features like the unique vertex .

  • Cross-linking studies: Chemical cross-linking combined with mass spectrometry can identify direct protein-protein interactions between P11 and other vertex components.

  • Time-course experiments: To understand the dynamic assembly process, time-resolved studies should be conducted to capture the sequential addition of proteins during vertex formation.

How can researchers effectively isolate and study recombinant P11 protein while maintaining its functional properties?

The effective isolation and study of recombinant P11 protein while preserving its functional properties requires a methodical approach:

  • Expression system selection:

    • Bacterial expression systems (e.g., E. coli) offer high yields but may lack post-translational modifications.

    • Eukaryotic systems may provide more accurate protein folding but with lower yields.

    • Cell-free systems allow for the synthesis of potentially toxic proteins.

  • Solubility enhancement strategies:

    • Fusion partners (e.g., MBP, SUMO, thioredoxin) can improve solubility.

    • Co-expression with partner proteins found in the native complex may stabilize P11.

    • Optimization of expression conditions (temperature, induction timing, media composition).

  • Purification protocol optimization:

    • Multi-step purification combining affinity, ion exchange, and size exclusion chromatography.

    • Use of mild detergents for membrane-associated protein portions.

    • Buffer optimization to maintain protein stability and prevent aggregation.

  • Functional assay development:

    • In vitro DNA binding and translocation assays to assess functionality.

    • ATPase activity measurements to evaluate energy utilization.

    • Structural integrity verification through circular dichroism spectroscopy.

  • Storage condition determination:

    • Cryoprotectant addition to prevent freeze-thaw damage.

    • Optimal buffer components (pH, salt concentration, stabilizing agents).

    • Aliquoting to minimize repeated freeze-thaw cycles.

Implementation of these methodological approaches can significantly improve the yield and quality of recombinant P11 protein for structural and functional studies.

What contradictions exist in current research regarding the mechanism of P11 in DNA packaging versus DNA ejection?

Current research reveals several unresolved contradictions regarding the dual role of P11 in both DNA packaging and ejection processes:

To resolve these contradictions, future research should employ time-resolved cryo-electron microscopy to capture the dynamic states of P11, utilize single-molecule techniques to observe DNA movement in real-time, and develop in vitro reconstitution systems to test specific hypotheses about P11's mechanical functions.

How does the structure-function relationship of P11 compare with DNA translocation proteins in other bacteriophages?

The structure-function relationship of P11 in bacteriophage PRD1 presents interesting comparisons with DNA translocation proteins in other phage systems:

Comparative Structural Features

Phage SystemTranslocation ProteinOligomeric StatePortal StructureMembrane Interaction
PRD1P11UnknownPart of unique vertex complexConnects to internal membrane via P20/P22
T4gp17Pentameric ringConnects to dodecameric portal (gp20)No membrane interaction
Phi29gp16Pentameric ringConnects to connector (gp10)No membrane interaction
P22gp2/gp3 complexMultimericConnects to dodecameric portalNo membrane interaction

Functional Comparisons

  • Energy utilization mechanism:
    While many phage packaging motors (like T4 gp17 and Phi29 gp16) are confirmed ATP-hydrolyzing enzymes, PRD1 P11's direct role in energy transduction is less clear. P11 may work in concert with the putative ATPase P9, potentially serving a more structural role in the translocation machinery .

  • Evolutionary relationships:
    PRD1 shows structural similarities to adenoviruses, suggesting an evolutionary relationship . This connection makes P11 particularly interesting for studying viral evolution across prokaryotic and eukaryotic systems, potentially representing an ancestral mechanism of DNA translocation.

  • Membrane association:
    PRD1's unique feature of an internal membrane sets it apart from many other bacteriophages. The connection of P11 to this membrane via proteins P20 and P22 represents a specialized adaptation potentially related to the formation of a membrane tube for DNA delivery .

  • Directional control:
    In tailed phages, the unidirectional movement of DNA is facilitated by the portal-tail architecture. For the tailless PRD1, the mechanism by which P11 and associated proteins control the directionality of DNA movement remains an important research question.

These comparative analyses highlight P11's unique position in phage biology and emphasize the importance of studying its structure-function relationships for understanding diverse mechanisms of viral DNA packaging and delivery.

What experimental approaches can resolve the symmetry mismatch between the icosahedral capsid and the P11-containing unique vertex?

Resolving the symmetry mismatch between PRD1's icosahedral capsid and its P11-containing unique vertex presents a significant technical challenge that requires specialized experimental approaches:

  • Focused Classification in Cryo-EM:
    Modern cryo-electron microscopy workflows can employ focused classification methods that identify and separately analyze particles based on the features of specific regions (like the unique vertex). This approach prevents the unique vertex from being averaged out during reconstruction and has been successful in resolving asymmetric features in otherwise symmetric virus particles .

  • Vertex-Specific Labeling Strategies:

    • Gold nanoparticle labeling of P11-specific antibodies

    • Genetic incorporation of tags at the P11 locus

    • Chemical crosslinking with mass spectrometry to identify spatial relationships

  • Structural Approaches for Asymmetric Features:

    • Sub-tomogram averaging focused specifically on vertices

    • Local refinement techniques that apply different symmetry assumptions to different parts of the structure

    • Computational subtraction of the icosahedral capsid signal to enhance the unique vertex features

  • Functional Asymmetry Validation:

    • Single-molecule fluorescence to track DNA movement through specific vertices

    • Vertex-specific chemical modification followed by functional assays

    • Construction of mutants with altered vertex numbers or distributions

  • Isolation of Vertex Complexes:
    Biochemical purification of the unique vertex complex can be achieved through:

    • Mild detergent treatment to release vertices

    • Density gradient centrifugation to separate different vertex types

    • Affinity purification using P11-specific interactions

The methodological pathway typically involves initial icosahedral reconstruction to resolve the capsid structure, followed by focused classification to identify the unique vertex, and finally local refinement around this vertex without imposing symmetry constraints. This multi-step approach has successfully revealed asymmetric features in other viruses and represents the most promising strategy for understanding P11's structural context.

What are the key biochemical properties of recombinant P11 protein that influence experimental design?

Understanding the biochemical properties of recombinant Enterobacteria phage PRD1 Infectivity protein P11 is essential for designing effective experiments. Several key properties should be considered:

  • Molecular weight and size:
    The exact molecular weight of P11 is important for purification strategies and functional studies. Protein size affects diffusion rates, binding kinetics, and structural analysis approaches.

  • Isoelectric point (pI):
    The pI determines the protein's charge at different pH values, which is critical for:

    • Designing purification strategies (ion exchange chromatography)

    • Optimizing buffer conditions

    • Understanding potential interaction partners

  • Solubility and hydrophobic properties:
    As a component of a DNA translocation complex that connects to membrane proteins, P11 likely has both hydrophilic and hydrophobic regions . Experimental designs must account for potential solubility challenges:

    Buffer ComponentPurposeTypical Range
    Salt concentrationShields ionic interactions150-500 mM NaCl
    DetergentSolubilizes hydrophobic regions0.01-0.1% non-ionic detergents
    pHMaintains protein stabilityTypically pH 7.0-8.0
    Stabilizing agentsPrevents aggregation5-10% glycerol, 1-5 mM reducing agents
  • Post-translational modifications:
    If P11 undergoes post-translational modifications in its native context, these must be considered when choosing an expression system for recombinant production.

  • Oligomerization state:
    While the oligomeric state of P11 is not explicitly stated in the available literature, its function as part of a DNA translocation complex suggests potential protein-protein interactions that might influence its structure and stability .

These biochemical properties should guide experimental design decisions, from expression system selection to buffer composition, ensuring that recombinant P11 maintains its native structure and function throughout experimental procedures.

How can researchers distinguish between functional and structural roles of P11 in the PRD1 phage life cycle?

Distinguishing between the functional and structural roles of P11 in the PRD1 phage life cycle requires a multi-faceted experimental approach:

  • Site-directed mutagenesis analysis:

    • Create a systematic library of P11 mutants with alterations in specific domains

    • Evaluate each mutant for:

      • Virus assembly completion

      • DNA packaging efficiency

      • Vertex complex formation

      • Host cell infection capability

    This approach can reveal which regions of P11 are essential for structural integrity versus functional activities.

  • Time-course analysis with synchronized infection:

    • Monitor P11 localization and interactions at different stages of the viral cycle using techniques such as:

      • Fluorescence microscopy with tagged P11 variants

      • Cross-linking mass spectrometry at defined time points

      • Pulse-chase labeling to track protein dynamics

    This reveals when and where P11 performs its various roles.

  • In vitro reconstitution experiments:

    • Assemble minimal systems with purified components to test specific functions:

      • DNA binding and translocation activity

      • Interaction with membrane components

      • ATP hydrolysis in the presence/absence of P11

  • Complementation assays:

    • Create P11-deficient viral particles

    • Attempt rescue with:

      • Wild-type P11

      • Mutant P11 variants

      • Homologous proteins from related phages

    This can differentiate between structural requirements and specific functional activities.

  • Structural studies with functional correlation:

    • Combine structural approaches (cryo-EM, X-ray crystallography) with functional assays

    • Map function-altering mutations onto structural models

    • Identify structural changes under different functional states (e.g., before and after DNA binding)

By integrating these approaches, researchers can develop a comprehensive model that distinguishes P11's roles as both a structural component of the unique vertex and a functional participant in DNA packaging and delivery mechanisms.

What is the current understanding of P11's interaction with the putative packaging ATPase P9?

The current understanding of P11's interaction with the putative packaging ATPase P9 reveals a complex relationship mediated through multiple proteins:

  • Indirect interaction pathway:
    Current evidence suggests that P11 and P9 do not interact directly but are connected through an interaction network involving protein P6. P9 appears to bind to the virus particle via protein P6, which is part of the same unique vertex complex that contains P11 .

  • Membrane protein connections:
    The unique vertex where P11 is located extends to the virus's internal membrane through integral membrane proteins P20 and P22. These membrane proteins are necessary for the binding of the putative packaging ATPase P9 (via P6) to the virus particle .

  • Functional coupling:
    Despite the lack of direct physical interaction, P11 and P9 are functionally coupled in the DNA packaging process:

    ProteinPrimary RoleEnergy InvolvementPositional Context
    P9Putative ATPaseATP hydrolysis (energy source)Associates via P6
    P11DNA translocationUtilizes energy from ATP hydrolysisPart of unique vertex
    P6ConnectorMediates P9 associationLinks components
    P20/P22Membrane extensionCreates channel to membraneIntegral membrane proteins
  • Structural arrangement models:
    While the precise structural arrangement remains to be fully elucidated, current models suggest that P11 forms part of a channel through which DNA moves, with P9 providing the energy for this movement through ATP hydrolysis. The energy is likely transmitted through conformational changes in the connecting proteins.

  • Research limitations:
    Several aspects of this interaction network remain unclear:

    • The stoichiometry of the different components

    • The exact sequence of protein assembly

    • The conformational changes that occur during DNA movement

    • The mechanism of energy transfer from ATP hydrolysis to mechanical movement

Future research directions should focus on capturing intermediate states of this complex during assembly and function, potentially through time-resolved cryo-EM or single-molecule techniques that can visualize the dynamics of these interactions.

What are the optimal conditions for expressing and purifying recombinant P11 protein for structural studies?

The optimization of expression and purification conditions for recombinant P11 protein involves several critical considerations to ensure the production of properly folded, functional protein suitable for structural studies:

Expression System Selection

Expression SystemAdvantagesDisadvantagesSuitability for P11
E. coliHigh yields, simple manipulationLimited post-translational modificationsGood for initial trials
Insect cellsBetter folding of complex proteinsMore time-consuming, expensivePreferred for structural studies
Mammalian cellsNative-like modificationsLow yields, expensiveOnly if specific modifications required
Cell-free systemsRapid, works with toxic proteinsExpensive, limited scaleUseful for preliminary optimization

Expression Optimization Protocol

  • Vector design considerations:

    • Include a cleavable affinity tag (His6, GST, or MBP)

    • Codon optimization for the expression host

    • Consider fusion partners that enhance solubility

    • Include TEV or PreScission protease sites for tag removal

  • Expression conditions:

    • Test multiple temperatures (18°C, 25°C, 30°C, 37°C)

    • Optimize induction timing and inducer concentration

    • Evaluate different media formulations (LB, TB, autoinduction)

    • Consider co-expression with chaperones if folding issues occur

  • Cell lysis and initial extraction:

    • Buffer optimization (pH 7.5-8.0 typically works well)

    • Include protease inhibitors

    • Test different lysis methods (sonication, French press, chemical lysis)

    • Evaluate detergents if membrane association is suspected based on P11's interactions with membrane proteins

Purification Strategy

  • Multi-step purification approach:

    • Initial capture: Affinity chromatography (IMAC for His-tagged proteins)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Consider tag removal between steps if required for structural studies

  • Buffer optimization for stability:

    • Test pH range (typically 7.0-8.0)

    • Optimize salt concentration (150-500 mM NaCl)

    • Include stabilizing agents (5-10% glycerol, 1 mM DTT or TCEP)

    • Consider additives based on functional requirements (e.g., divalent cations)

  • Quality control checkpoints:

    • SDS-PAGE and Western blotting to confirm identity

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assays to evaluate stability

    • Limited proteolysis to identify flexible regions

By systematically optimizing these conditions, researchers can develop a robust protocol for producing pure, homogeneous P11 protein suitable for crystallization, cryo-EM, or other structural techniques.

How can researchers effectively design experiments to study the dynamics of P11 during DNA translocation?

Studying the dynamics of P11 during DNA translocation requires specialized experimental approaches that can capture transient states and molecular movements:

  • Single-molecule fluorescence techniques:

    • Fluorescence Resonance Energy Transfer (FRET) to measure distance changes between labeled domains of P11 or between P11 and DNA

    • Setup: Label P11 with donor/acceptor fluorophores at strategic positions

    • Analysis: Changes in FRET efficiency indicate conformational changes during translocation

    • Key advantage: Can observe individual molecules rather than ensemble averages

  • Time-resolved cryo-EM approaches:

    • Microfluidic mixing devices to capture transient states

    • Protocol: Mix PRD1 particles with ATP or other triggering molecules with defined time delays before vitrification

    • Analysis: Sort particles based on conformational states to identify intermediates

    • Special consideration: Focus classification to specifically examine the unique vertex containing P11

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Principle: Exposed protein regions exchange hydrogen atoms with deuterium more rapidly

    • Experimental design: Compare exchange patterns in different functional states (resting, ATP-bound, DNA-bound)

    • Analysis: Identifies regions undergoing conformational changes during the translocation cycle

    • Advantage: Does not require protein modification

  • Molecular dynamics simulations complemented by experimental constraints:

    • Create atomic models based on available structural data

    • Apply experimental constraints from cross-linking or other techniques

    • Simulate potential conformational changes during translocation

    • Validate predictions with targeted experiments

  • Real-time fluorescence microscopy of DNA translocation:

    • System: Reconstituted P11-containing complexes with fluorescently labeled DNA

    • Measurement: Track DNA movement through the channel in real-time

    • Analysis: Correlate DNA movement with biochemical states (ATP binding/hydrolysis)

    • Challenge: Requires functional reconstitution of the translocation complex

  • Site-directed spin labeling with electron paramagnetic resonance (EPR):

    • Approach: Introduce spin labels at specific residues in P11

    • Measurement: Distance changes between labels during functional cycles

    • Advantage: Works in solution without crystallization

    • Application: Particularly useful for mapping movements of specific domains

These approaches can be integrated to develop a comprehensive model of P11 dynamics during DNA translocation, capturing both structural rearrangements and their correlation with functional states of the packaging motor.

What strategies can resolve contradictions in data when comparing in vitro and in vivo studies of P11 function?

Resolving contradictions between in vitro and in vivo studies of P11 function requires systematic approaches to bridge these different experimental contexts:

  • Controlled complexity approach:

    • Start with minimal in vitro systems containing only P11

    • Systematically add components (P6, P9, membrane proteins) to approach in vivo complexity

    • Identify at which stage in vitro behavior begins to match in vivo observations

    • This reveals which components or conditions are critical for native function

  • Comparable condition alignment:

    • Adjust in vitro conditions to better match cellular environment:

      • Ion concentrations (particularly Mg2+, K+)

      • Macromolecular crowding agents (PEG, Ficoll)

      • Redox environment

      • Temperature and pH

    • Compare functional parameters across a range of conditions to identify sensitive variables

  • Validation through genetic approaches:

    • Generate specific P11 mutations based on in vitro findings

    • Test these mutations in vivo using phage genetic systems

    • Correlation between in vitro biochemical effects and in vivo phenotypes validates mechanistic models

    ApproachStrengthsLimitationsResolution Strategy
    In vitro biochemistryPrecise control, component analysisMay lack essential factorsAdd complexity stepwise
    Structural studiesAtomic detail, stable statesOften static snapshotsCapture multiple states
    Genetic analysisPhysiological relevanceIndirect readoutsStructure-guided mutations
    Cell biologyNatural contextLimited manipulationDevelop minimal cell systems
  • Development of semi-in vivo systems:

    • Permeabilized cell systems that allow controlled addition of components

    • Liposome reconstitution with native membrane components

    • Cell-free expression systems supplemented with cellular extracts

    • These bridge the gap between fully artificial and fully natural systems

  • Collaborative data reconciliation workflow:

    • When contradictions arise:

      1. Precisely define the contradiction in quantitative terms

      2. Identify all variables that differ between experimental systems

      3. Test each variable individually where possible

      4. Develop integrative models that explain both sets of observations

      5. Design critical experiments to distinguish between models

By implementing these strategies, researchers can develop a more comprehensive understanding of P11 function that reconciles observations across different experimental contexts, leading to models with both mechanistic detail and physiological relevance.

What are the best approaches for studying potential conformational changes in P11 during the viral infection cycle?

Studying conformational changes in P11 during the viral infection cycle requires techniques that can capture structural dynamics across different functional states:

  • Cryogenic electron microscopy (cryo-EM) with focused classification:

    • Sample preparation: Capture PRD1 particles at different stages of infection

    • Data collection: High-resolution imaging with emphasis on particle orientation diversity

    • Analysis: Focused classification specifically on the unique vertex containing P11

    • Advantage: Can resolve asymmetric features without icosahedral averaging

    • Challenge: Requires sufficient particle numbers in each functional state

  • Time-resolved structural studies:

    • Synchronize infection and capture snapshots at defined timepoints

    • Combine with rapid freezing techniques to vitrify samples

    • Structural determination of each timepoint reveals sequential conformational changes

    • Consider microfluidic mixing devices for sub-second timepoint resolution

  • Site-specific labeling strategies:

    • Introduce cysteine residues at strategic positions in P11 for labeling

    • Apply different spectroscopic techniques:

      • Fluorescence resonance energy transfer (FRET) for distance measurements

      • Site-directed spin labeling (SDSL) with EPR for orientation information

      • Environment-sensitive fluorophores to detect local changes

  • Cross-linking mass spectrometry (XL-MS):

    • Apply chemical cross-linkers to PRD1 particles in different functional states

    • Digest proteins and identify cross-linked peptides by mass spectrometry

    • Compare cross-linking patterns between states to identify conformational differences

    • Advantage: Can map interaction surfaces and proximity relationships

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose PRD1 particles to deuterated buffer for varying times

    • Analyze the rate and extent of hydrogen-deuterium exchange in P11

    • Compare exchange patterns between functional states

    • Identifies regions becoming more exposed or protected during conformational changes

  • Integrative structural modeling:

    • Combine data from multiple experimental approaches

    • Generate models consistent with all experimental constraints

    • Simulate potential conformational transitions between states

    • Validate with targeted experiments testing model predictions

  • Functional correlation with structural states:

    • Design assays that measure specific P11 functions:

      • DNA binding

      • Interaction with other vertex proteins

      • Channel formation/gating

    • Correlate functional measurements with structural observations

    • Identify structure-function relationships

By combining these approaches, researchers can develop dynamic models of P11 conformational changes that correlate with specific stages in the viral infection cycle, from assembly and DNA packaging to receptor binding and DNA ejection.

What emerging technologies could advance our understanding of P11's role in the PRD1 infection mechanism?

Several cutting-edge technologies show particular promise for advancing our understanding of P11's role in the PRD1 infection mechanism:

  • Cryo-electron tomography with sub-tomogram averaging:
    This technology allows visualization of structures in their native cellular context without requiring purification or crystallization. For P11 research, this could:

    • Visualize PRD1 during actual infection of bacterial cells

    • Capture intermediate states of DNA translocation in situ

    • Resolve the native conformation of the unique vertex in cellular environments

  • Time-resolved X-ray free-electron laser (XFEL) crystallography:
    This technique can capture ultrafast structural changes:

    • Visualize conformational changes in the millisecond to femtosecond range

    • Potentially capture the transitional states of P11 during DNA movement

    • Provide atomic-level detail of structural rearrangements during function

  • Integrative structural biology platforms:
    Combining multiple data types using computational frameworks:

    • Integrate lower-resolution cryo-EM data with high-resolution X-ray structures

    • Incorporate distance constraints from FRET or cross-linking experiments

    • Develop complete models of the P11-containing vertex complex

  • AlphaFold2 and deep learning approaches:
    These AI-based tools can predict protein structures and interactions:

    • Model full-length P11 structure and its complexes with other vertex proteins

    • Predict potential conformational changes during function

    • Generate hypotheses for experimental validation

  • In-cell structural biology methods:
    Technologies that can determine structures within living cells:

    • In-cell NMR to detect conformational changes during infection

    • Proximity labeling techniques to map interaction networks

    • Genetic code expansion for site-specific probe incorporation

  • High-throughput mutagenesis combined with deep sequencing:
    Systematic analysis of structure-function relationships:

    • Create comprehensive libraries of P11 variants

    • Screen for functional phenotypes (packaging efficiency, infectivity)

    • Map functional requirements to specific residues or structural elements

  • Microfluidic single-virus manipulation systems:
    These allow precise control and observation of individual viral particles:

    • Observe DNA packaging/ejection in real-time at the single-virus level

    • Correlate structural changes with functional outcomes

    • Test the effects of environmental conditions on P11 function

These emerging technologies could overcome current limitations in studying P11, particularly in capturing its dynamic behavior during the infection process and resolving its structure in the context of the asymmetric vertex complex.

How might comparative analysis of P11 homologs in related phages contribute to understanding evolutionary adaptations in viral DNA packaging?

Comparative analysis of P11 homologs across related phages provides a powerful framework for understanding evolutionary adaptations in viral DNA packaging machinery:

  • Phylogenetic mapping of functional innovations:

    • Identify P11 homologs across diverse phage families

    • Map functional variations onto phylogenetic trees

    • Trace the evolutionary history of specific adaptations

    • Correlate with host range changes and environmental niches

  • Structure-based comparative analysis:

    Phage FamilyP11 HomologStructural FeaturesFunctional SpecializationHost Range
    Tectiviridae (PRD1)P11Part of unique vertexDNA translocationGram-negative bacteria
    CorticoviridaePotential homologsTo be determinedTo be determinedMarine bacteria
    AdenoviridaeRelated proteins?Similar vertex organizationDNA packaging in eukaryotic virusesVertebrates
  • Identification of conserved functional domains:

    • Core domains preserved across distant relatives likely represent essential functions

    • Variable regions may indicate host-specific adaptations

    • Conserved interaction surfaces suggest fundamental mechanistic principles

    • Insertion/deletion events may correlate with functional innovations

  • Co-evolution analysis of interacting partners:

    • Examine how changes in P11 correlate with changes in other packaging proteins

    • Identify compensatory mutations that maintain functional interactions

    • Map the evolutionary trajectory of entire packaging complexes

    • Understand how new protein-protein interfaces develop

  • Functional testing through domain swapping:

    • Create chimeric proteins with domains from different viral P11 homologs

    • Test function in both original contexts

    • Identify which domains determine specificity versus generalized function

    • Understand modular nature of packaging machinery

  • Correlation with viral genome properties:

    • Analyze how P11 variations relate to differences in:

      • Genome size and packaging density

      • DNA modifications and packaging signals

      • Ejection mechanisms and kinetics

    • Identify adaptations specific to each genome packaging challenge

  • Evolutionary reconstructions:

    • Use ancestral sequence reconstruction to predict ancestral P11 proteins

    • Experimentally test these reconstructed proteins

    • Understand the evolutionary pathway that led to current diversity

    • Potentially identify simplified, more ancient packaging mechanisms

This comparative approach not only enhances our understanding of P11 specifically but contributes to broader knowledge about viral evolution, particularly regarding the significant evolutionary relationship between bacteriophage PRD1 and adenoviruses that has contributed to current ideas on virus phylogeny .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.