Recombinant Enterobacteria phage PRD1 Protein P35 (XXXV)

Shipped with Ice Packs
In Stock

Description

Gene Organization and Expression

The P35 protein is encoded by gene XXXV in the PRD1 genome. The gene has been extensively studied through various mutational analyses, including nonsense, missense, and insertion mutations . These studies have provided valuable insights into the functional domains of the protein and their contributions to host cell lysis.

Table 1: Key Molecular Characteristics of PRD1 P35 Protein

FeatureDescription
Protein NameP35 (XXXV)
GeneXXXV
UniProt IDQ3T4L9
SynonymsXXXV; Holin; Protein P35
Molecular Weight12.8 kDa
Amino Acid Length117 amino acids
Protein ClassClass I lambdoid-type holin
Key Functional RegionCharged C-terminus

Functional Role in Viral Life Cycle

The P35 protein serves as a critical component in the PRD1 phage infection process, specifically in the final stages of viral reproduction where it facilitates host cell lysis.

Holin Function

P35 functions as a holin protein, a class of phage-encoded membrane proteins that create pores in the host cell's cytoplasmic membrane . These pores allow endolysins (peptidoglycan-degrading enzymes) to access the bacterial cell wall, ultimately leading to cell lysis and release of newly assembled viral particles .

Research has demonstrated that P35 is essential for the membrane permeabilization step in host cell lysis . Without functional P35, the phage cannot efficiently release its progeny from the infected host cell, severely limiting its reproductive capabilities.

Two-Component Lysis System

PRD1 employs a two-component lysis system consisting of:

  1. P35 (holin) - Creates membrane pores

  2. P15 (endolysin) - Degrades peptidoglycan

This system operates in a coordinated manner, with P35-created membrane permeabilization preceding the activity of P15, which is a soluble β-1,4-N-acetylmuramidase that effectively degrades the peptidoglycan layer of the gram-negative bacterial cell wall . Together, these two proteins accomplish the complete lysis of the host cell.

Physiological Effects During Lysis

Studies monitoring ion fluxes and ATP content in PRD1-infected cells have revealed the sequence of physiological changes that occur during the lysis process . The earliest indicator of impending cell lysis is a decrease in intracellular ATP levels, followed by leakage of potassium ions . This suggests that P35-mediated membrane permeabilization disrupts cellular energetics before complete structural breakdown occurs.

Experimental Findings on P35 Function

Extensive research has been conducted to understand the precise mechanism and regulation of P35 activity in the PRD1 lytic cycle.

Mutational Analysis

Multiple mutational studies have been conducted on gene XXXV to understand structure-function relationships in the P35 protein . These studies have revealed that:

  1. The charged amino acids at the C-terminus of P35 are critical for regulating the timing of host cell lysis

  2. Various nonsense, missense, and insertion mutations in gene XXXV have been analyzed, providing insights into essential regions of the protein

  3. Defects in PRD1 gene XXXV can be functionally complemented by the presence of gene S from bacteriophage lambda, demonstrating functional similarity between these holin proteins

Premature Lysis Studies

A notable characteristic of PRD1-infected cells is their susceptibility to premature lysis upon addition of metabolic inhibitors such as cyanide . This phenomenon has provided valuable insights into the energy-dependent regulation of P35 activity:

  1. The addition of cyanide (which blocks respiration by inhibiting cytochrome oxidase) to PRD1-infected cells triggers premature lysis

  2. This effect supports the existence of a highly regulated two-component lysis system in PRD1

  3. Arsenate has been found to be particularly effective in triggering premature lysis in PRD1-infected cells

These findings suggest that P35 activity is tightly regulated by cellular energetics, with energy depletion serving as a trigger for P35-mediated membrane permeabilization.

Relationship with Accessory Lysis Proteins

Recent research has identified two additional lysis-related genes in PRD1: XXXVI and XXXVII, which encode proteins P36 and P37, respectively . These proteins have been characterized as accessory lysis proteins functionally analogous to the Rz/Rz1 proteins of bacteriophage λ . While distinct from P35, these proteins operate in conjunction with the holin-endolysin system to ensure efficient host cell disruption under various environmental conditions .

Expression and Purification

Recombinant full-length Enterobacteria phage PRD1 Protein P35 (XXXV) is produced using standardized expression systems:

  1. The full-length protein (amino acids 1-117) is expressed in E. coli expression systems

  2. The recombinant protein typically includes an N-terminal His-tag to facilitate purification

  3. The expressed protein maintains the complete amino acid sequence of the native P35 protein

Research Applications and Significance

The study of P35 protein has contributed significantly to our understanding of viral lysis mechanisms and has potential applications in various fields.

Model for Viral Lysis Studies

P35 has served as an important model protein for understanding the general principles of phage-mediated bacterial lysis:

  1. Its function as a holin protein exemplifies a common mechanism used by many bacteriophages to accomplish host cell lysis

  2. The well-characterized nature of PRD1 infection makes P35 an excellent model for studying the regulated timing of viral lysis

  3. The interchangeability of P35 with the lambda S protein demonstrates evolutionary conservation of holin function across different phage families

Implications for Phage-Host Interactions

Studies involving P35 have contributed to our understanding of the evolutionary relationships between phages and their bacterial hosts:

  1. PRD1 infects gram-negative bacteria harboring conjugative IncP plasmids such as RP4 and pKJK5

  2. The plasmid-dependent nature of PRD1 infection represents an interesting evolutionary strategy, allowing the phage to target bacteria across different taxonomic groups that share conjugative plasmids

  3. Understanding P35 function provides insights into how phages can exploit specific bacterial vulnerabilities

Potential Biotechnological Applications

The lytic properties of P35 suggest potential applications in biotechnology and medicine:

  1. As a model for the development of novel antimicrobial agents targeting bacterial membranes

  2. In phage therapy applications, where understanding lysis mechanisms is crucial for therapeutic efficacy

  3. For controlled lysis of bacterial cells in biotechnological processes where gentle and regulated cell disruption is required

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
XXXV; Holin; Protein P35
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Enterobacteria phage PRD1 (Bacteriophage PRD1)
Target Names
XXXV
Target Protein Sequence
MMENDEWWKYLIFPLVATLGGIVNYSKRALAMKRFSKLEFAVEAVSAAFVGLMVTLGGAA MDLSPHWLGMAAGMSGWMGADFVKAVFSQFVQSKIAPINQPGPIDSDNDKPGRTFND
Uniprot No.

Target Background

Function
**Isoform Holin:** Accumulates harmlessly in the cytoplasmic membrane until it reaches a critical concentration. This triggers the formation of micron-scale pores (holes), causing host cell membrane disruption and the release of endolysin into the periplasmic space. Holin determines the precise timing of host cell lysis. It collaborates with the endolysin and spanin proteins in a sequential process that leads to programmed host cell lysis, releasing mature viral particles from the host cell.
**Isoform Antiholin:** Counteracts the aggregation of holin molecules, preventing pore formation.
Database Links

KEGG: vg:5729504

Subcellular Location
Host cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of PRD1 Protein P35 (XXXV)?

PRD1 Protein P35 is a holin protein that functions as part of a two-component lysis system in bacteriophage PRD1. Holins are phage-induced integral membrane proteins that regulate the access of lytic enzymes to the host cell peptidoglycan at the time of progeny virus release. P35 specifically forms membrane pores that allow the phage endolysin (protein P15) to reach the peptidoglycan layer, causing host cell lysis . The protein works in concert with the P15 endolysin, which is a soluble β-1,4-N-acetylmuramidase that effectively degrades the peptidoglycan of the gram-negative bacterial cell wall .

How does the PRD1 holin system compare to other phage holin systems?

The PRD1 holin (P35) shares functional similarities with the lambda phage holin (gene S product) despite limited sequence homology. Evidence for this functional conservation comes from complementation studies where the defect in PRD1 gene XXXV can be corrected by the presence of gene S of lambda phage . Like other class I holins, P35 likely forms large pores in the cytoplasmic membrane, allowing the passive diffusion of endolysin to its substrate in the cell wall. The PRD1 lysis system follows the typical two-component architecture (holin-endolysin) observed in many double-stranded DNA phages, but represents a system specific to phages infecting gram-negative bacteria with a conjugative IncP plasmid .

What techniques have been used to identify and characterize PRD1 Protein P35?

Several complementary techniques have been employed to identify and characterize PRD1 Protein P35:

  • Genetic approaches: Isolation of nonsense mutants and analysis of complementation groups to identify gene XXXV

  • Cloning and sequencing: Cloning gene XXXV into expression vectors and determining its sequence

  • Mutational analysis: Generation of nonsense, missense, and insertion mutations to study protein function

  • Complementation studies: Testing functional interchangeability with other holin proteins (e.g., lambda S gene)

  • Physiological measurements: Monitoring ion fluxes (K+ efflux), membrane potential (using TPP+), and cellular ATP levels to track lysis events

  • Premature lysis induction: Using metabolic inhibitors like cyanide and arsenate to trigger early lysis and study holin function

These approaches collectively established P35 as a bona fide holin protein and elucidated its role in the PRD1 lysis pathway.

How can recombinant PRD1 Protein P35 be effectively expressed and purified?

Recombinant PRD1 Protein P35 can be expressed in E. coli using appropriate expression vectors. Based on available information:

  • Expression system: The full-length protein (amino acids 1-117) can be expressed with an N-terminal His-tag in E. coli .

  • Vector selection: High-level expression vectors like pET32a have been successfully used for P35 expression .

  • Host strain considerations: Expression in E. coli strains containing pLysS may help reduce basal expression levels and toxicity .

  • Purification approach: His-tagged P35 can be purified using affinity chromatography.

  • Storage recommendations: The purified protein should be stored in Tris/PBS-based buffer (pH 8.0) with 6% trehalose. For long-term storage, aliquoting with 5-50% glycerol and storage at -20°C/-80°C is recommended .

  • Stability considerations: Repeated freeze-thaw cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

How do mutations in PRD1 Protein P35 affect lysis timing and efficiency?

Various mutations in PRD1 Protein P35 have revealed critical insights about structure-function relationships:

  • C-terminal charged residues: Mutations affecting the charged amino acids at the C-terminus have been shown to alter the timing of host cell lysis, suggesting this region functions as a molecular clock regulating lysis timing .

  • Nonsense mutations: Several nonsense mutants (including sus711, sus712, sus714, sus715, sus716, and sus718) have been characterized and mapped to gene XXXV, providing evidence for its essential role in the lysis process .

  • Insertion mutations: PRD1 insertional mutants (including 13272, 13273, 13284, 13290, 13300, and 13315) generated using Mu in vitro transposition technology have been used to identify genomic regions tolerant to insertion and genes not essential for virus propagation .

  • Point mutations: Point mutations created through targeted mutagenesis approaches have helped define specific amino acid residues critical for holin function and regulation .

What are the physiological indicators of PRD1 holin activity during infection?

PRD1 holin activity during infection can be monitored through several physiological changes that occur in a specific sequence:

  • ATP depletion: The earliest detectable indicator of cell lysis is a decrease in intracellular ATP levels .

  • K+ efflux: Following ATP depletion, leakage of potassium ions from the cell indicates increased cytoplasmic membrane permeability due to holin pore formation .

  • Membrane depolarization: Changes in membrane potential, monitored using lipophilic cations like tetraphenylphosphonium (TPP+), indicate holin-mediated membrane permeabilization .

  • Cell lysis: Ultimate rupture of the cell due to endolysin activity, releasing phage progeny .

This sequence of events provides a comprehensive picture of holin-mediated lysis progression and can be used as a framework for studying lysis kinetics in different mutant backgrounds.

How does the PRD1 two-component lysis system operate in molecular detail?

The PRD1 two-component lysis system operates through coordinated action of holin (P35) and endolysin (P15):

  • Initial phase: During phage replication, both holin and endolysin proteins accumulate in the infected cell.

  • Holin accumulation: P35 integrates into the cytoplasmic membrane but does not immediately form pores, allowing phage assembly to proceed.

  • Triggering event: At a genetically programmed time, holin proteins oligomerize to form pores in the cytoplasmic membrane, causing membrane depolarization.

  • Endolysin access: These pores allow the accumulated endolysin (P15) to access the peptidoglycan layer.

  • Cell wall degradation: P15, a β-1,4-N-acetylmuramidase, degrades the peptidoglycan layer, leading to cell lysis and release of progeny phages .

  • Premature triggering: This system can be prematurely activated by metabolic inhibitors like cyanide and arsenate, which likely affect the energized state of the membrane .

This coordinated mechanism ensures that lysis occurs at the optimal time for maximum phage production, balancing the need for sufficient progeny production against the benefit of early release.

What assays can effectively measure PRD1 holin activity in experimental settings?

Several complementary assays can be employed to measure PRD1 holin activity:

  • Cell viability and lysis assays:

    • Monitoring culture turbidity using a colorimeter or spectrophotometer to track lysis profiles

    • Plaque formation assays to determine phage viability and lysis efficacy

  • Physiological parameter measurements:

    • ATP quantification assays to detect early changes in cellular energy state

    • Potassium-selective electrode measurements to monitor K+ efflux

    • Membrane potential assays using TPP+ to track membrane depolarization

  • Genetic complementation assays:

    • Expression of cloned PRD1 gene XXXV in holin-deficient backgrounds

    • Testing the ability of lambda phage gene S to complement PRD1 holin mutants

  • Premature lysis induction:

    • Application of metabolic inhibitors (cyanide, arsenate) to trigger early lysis in infected cells

    • Quantification of lysis timing shifts in response to different triggers

These assays provide multilayered information about holin function, from molecular activity to whole-cell physiological effects.

What are the critical controls needed when studying PRD1 Protein P35 function?

When studying PRD1 Protein P35 function, several critical controls should be included:

  • Negative controls:

    • Uninfected host cells to establish baseline measurements

    • PRD1 holin-deficient mutants (e.g., sus711, sus712) to demonstrate holin-dependent effects

    • Empty vector controls for recombinant expression studies

  • Positive controls:

    • Wild-type PRD1 infection to establish normal lysis timing and efficiency

    • Known functional holins (e.g., lambda S gene product) for comparative studies

  • Complementation controls:

    • Expression of wild-type gene XXXV in holin-deficient backgrounds

    • Cross-complementation with heterologous holins

  • Technical controls:

    • Media-only controls for background measurements

    • Metabolic inhibitor-only treatments to establish direct effects on uninfected cells

    • Time-matched samples to account for culture aging effects

Including these controls ensures that observed effects can be confidently attributed to PRD1 Protein P35 function rather than experimental artifacts or secondary effects.

How should researchers interpret physiological data from PRD1 holin activity studies?

When interpreting physiological data from PRD1 holin activity studies, researchers should consider:

  • Temporal sequence of events:

    • ATP depletion typically precedes K+ efflux, which precedes complete cell lysis

    • Deviations from this sequence may indicate alternative lysis mechanisms

  • Magnitude and rate analysis:

    • The rate of K+ efflux correlates with the rate of holin pore formation

    • The magnitude of ATP depletion reflects the degree of membrane permeabilization

  • Comparative analysis:

    • Compare wild-type PRD1 infection with holin mutants to identify specific P35 effects

    • Compare effects of different metabolic inhibitors on lysis timing

  • Integration of multiple parameters:

    • Correlate ATP levels, ion fluxes, membrane potential, and optical density data

    • Develop models of the sequence of physiological changes during lysis

  • Mutation-specific effects:

    • C-terminal mutations may affect timing without altering the fundamental lysis mechanism

    • Some mutations may affect pore size or conductance rather than timing

This integrated approach to data interpretation allows researchers to develop comprehensive models of holin function and regulation.

What insights have been gained from structure-function analyses of PRD1 Protein P35?

Structure-function analyses of PRD1 Protein P35 have revealed several key insights:

  • Functional domains:

    • The C-terminal region contains charged amino acids critical for regulating lysis timing

    • Transmembrane domains are essential for membrane integration and pore formation

  • Functional similarities:

    • Despite limited sequence homology, PRD1 P35 can be functionally replaced by lambda phage gene S product, suggesting conservation of critical structural elements

  • Mutational effects:

    • Multiple types of mutations (nonsense, missense, insertion) have demonstrated the essential nature of gene XXXV in the PRD1 lytic cycle

    • Specific mutations have mapped regions important for timing versus pore formation

  • Physiological mechanism:

    • P35 forms pores that allow the movement of small molecules including ions and ATP

    • These pores ultimately enable endolysin access to the peptidoglycan layer

These insights collectively support a model where PRD1 Protein P35 functions as a precisely regulated membrane-permeabilizing protein with specific structural elements controlling its activation timing.

What are the most promising approaches for studying PRD1 holin structure-function relationships?

Several promising approaches could advance our understanding of PRD1 holin structure-function relationships:

  • High-resolution structural studies:

    • Cryo-electron microscopy of membrane-embedded P35 oligomers

    • NMR studies of solubilized protein domains

    • X-ray crystallography of stabilized protein complexes

  • Advanced mutagenesis approaches:

    • Systematic alanine scanning mutagenesis of the full protein

    • Targeted modification of charged residues at the C-terminus

    • Creation of chimeric holins combining domains from different phages

  • Single-molecule techniques:

    • Patch-clamp electrophysiology to characterize pore conductance

    • Single-molecule fluorescence to track protein oligomerization

    • Real-time imaging of membrane permeabilization events

  • Computational approaches:

    • Molecular dynamics simulations of membrane insertion and pore formation

    • Ab initio modeling of three-dimensional structure

    • Prediction of protein-protein interaction sites

  • Host-pathogen interaction studies:

    • Investigation of host factors affecting holin function

    • Analysis of membrane composition effects on timing and efficiency

These approaches would provide complementary insights into the structural basis of PRD1 holin function and regulation.

How might PRD1 Protein P35 research contribute to broader bacteriophage applications?

Research on PRD1 Protein P35 has implications for several broader bacteriophage applications:

  • Phage therapy development:

    • Engineering holins with modified lysis timing could optimize phage therapy efficacy

    • Understanding lysis mechanisms helps predict phage behavior in therapeutic contexts

  • Biotechnology applications:

    • Holins could be engineered as controlled cell lysis tools for recombinant protein release

    • P35 variants might serve as regulatable membrane permeabilization agents

  • Synthetic biology:

    • PRD1 lysis components could be incorporated into synthetic gene circuits requiring timed lysis

    • The two-component system provides modular parts for synthetic biology applications

  • Antimicrobial development:

    • Holin-inspired peptides might serve as novel antimicrobial agents

    • Understanding holin function could inform strategies to potentiate conventional antibiotics

  • Fundamental virology:

    • Comparative studies of diverse holins illuminate evolutionary relationships

    • Mechanistic insights inform models of phage-host co-evolution

These diverse applications highlight the significance of basic research on phage lysis mechanisms for both fundamental science and applied technologies.

What are the optimal buffer conditions for maintaining recombinant PRD1 Protein P35 stability?

Optimal buffer conditions for maintaining recombinant PRD1 Protein P35 stability include:

ParameterRecommended ConditionNotes
Buffer baseTris/PBS-based bufferMaintains physiological compatibility
pH8.0Optimal for protein stability
Stabilizing agent6% TrehalosePreserves structure during freeze-thaw
Storage additive5-50% Glycerol (final)Prevents freeze damage; 50% is standard
Storage temperature-20°C/-80°CFor long-term storage in aliquots
Working storage4°CFor up to one week
ReconstitutionDeionized sterile waterTo concentration of 0.1-1.0 mg/mL
Freeze-thawMinimize cyclesRepeated freezing and thawing not recommended

Following these storage recommendations helps maintain the structural integrity and functional activity of recombinant PRD1 Protein P35 .

What techniques are effective for studying PRD1 holin oligomerization and pore formation?

Several techniques can effectively study PRD1 holin oligomerization and pore formation:

  • Biochemical approaches:

    • Cross-linking studies to capture oligomeric states

    • Blue-native PAGE to analyze protein complexes

    • Size exclusion chromatography to separate different oligomeric forms

  • Biophysical techniques:

    • Fluorescence resonance energy transfer (FRET) to detect protein-protein interactions

    • Analytical ultracentrifugation to determine oligomer size and shape

    • Small-angle X-ray scattering for low-resolution structural information

  • Functional assays:

    • Liposome permeabilization assays using fluorescent dyes

    • Planar lipid bilayer electrophysiology to measure pore conductance

    • Atomic force microscopy to visualize membrane-embedded complexes

  • Computational approaches:

    • Molecular dynamics simulations of oligomerization

    • Protein-protein docking to predict interaction interfaces

    • Coarse-grained modeling of membrane insertion

  • Genetic approaches:

    • Suppressor mutation analysis to identify interacting residues

    • Split protein complementation assays to detect oligomerization in vivo

These diverse approaches provide complementary information about the molecular mechanisms of PRD1 holin assembly and function.

How does PRD1 Protein P35 compare with holins from other bacteriophage families?

PRD1 Protein P35 shares functional similarities but has distinct characteristics compared to holins from other bacteriophage families:

FeaturePRD1 P35Lambda ST4 TOther Holins
Size12.8 kDa (117 aa)~8-11 kDa (varies by isoform)18.5 kDaVariable
ClassificationLikely Class IClass IClass IIIClasses I-III
Membrane topologyMultiple TMDs3 TMDs1 TMDVariable
Dual-start motifNot reportedYes (S105/S107)NoVariable
Cross-complementationCan be complemented by lambda SCan complement PRD1LimitedPhage-specific
Regulatory mechanismC-terminal charged residuesN-terminal dual startRegulated by TVariable
Pore sizeSmall molecule passageLarge, >nmSmallVariable

Despite these differences, PRD1 P35 maintains the core holin function of timing-regulated membrane permeabilization to allow endolysin access to peptidoglycan . The functional interchangeability with lambda S protein suggests conservation of critical structural elements despite limited sequence homology .

What insights from PRD1 holin studies apply to understanding other membrane-permeabilizing proteins?

Studies of PRD1 holin provide several insights applicable to other membrane-permeabilizing proteins:

  • Timing regulation mechanisms:

    • The role of charged residues in controlling oligomerization timing

    • The influence of membrane potential on activation

    • Energy-dependent inhibition of premature pore formation

  • Pore formation principles:

    • Stepwise progression from monomers to functional pores

    • Relationship between protein structure and pore size/selectivity

    • Role of specific amino acids in determining pore characteristics

  • Physiological consequences:

    • Sequence of events following membrane permeabilization (ATP depletion, ion fluxes)

    • Differential permeability to various cellular components

    • Interactions between pore-forming proteins and cellular energy state

  • Structure-function relationships:

    • Essential domains for membrane integration versus pore formation

    • Conservation of functional mechanisms despite sequence divergence

    • Molecular determinants of timing versus pore size

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.