Recombinant Enterobacteria phage T4 Lysis protein (t)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
t; rV; Holin; Lysis protein; Protein rV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Enterobacteria phage T4 (Bacteriophage T4)
Target Names
t
Target Protein Sequence
MAAPRISFSPSDILFGVLDRLFKDNATGKVLASRVAVVILLFIMAIVWYRGDSFFEYYKQ SKYETYSEIIEKERTARFESVALEQLQIVHISSEADFSAVYSFRPKNLNYFVDIIAYEGK LPSTISEKSLGGYPVDKTMDEYTVHLNGRHYYSNSKFAFLPTKKPTPEINYMYSCPYFNL DNIYAGTITMYWYRNDHISNDRLESICAQAARILGRAK
Uniprot No.

Target Background

Function
This protein accumulates harmlessly within the cytoplasmic membrane until a critical concentration is reached, triggering the formation of micron-scale pores. This pore formation disrupts the host cell membrane, allowing endolysin to escape into the periplasmic space. It precisely controls the timing of host cell lysis, and participates with endolysin and spanin proteins in the sequential events leading to programmed host cell lysis and the release of mature viral particles.
Gene References Into Functions
  1. The periplasmic domain of T4 lysozyme plays a crucial role in transducing environmental information to control lysis timing in real-time. (PMID: 16166524)
Database Links

KEGG: vg:1258610

Protein Families
T4likevirus holin family
Subcellular Location
Host cell inner membrane; Single-pass type II membrane protein; Periplasmic side.

Q&A

What is the primary function of T4 lysis protein (T) in the phage infection cycle?

T4 lysis protein (T) functions as a holin that allows the phage's lysozyme (endolysin) to reach the peptidoglycan (murein) layer of the bacterial cell envelope, causing cell lysis. The protein creates pores in the bacterial inner membrane that enable nonspecific escape of the phage endolysin, resulting in rapid destruction of the peptidoglycan layer . Unlike many other holins that consist of multiple transmembrane domains, T is unique in having a single N-terminal transmembrane domain tethering a substantial periplasmic domain (19.2 kDa, 163 amino acids) to the bilayer . This structure suggests T has evolved a specialized mechanism for controlling the timing of host cell lysis.

What is the structural organization of T4 lysis protein?

T4 lysis protein (T) is a 25.2 kDa type II integral membrane protein composed of:

  • A small N-terminal cytoplasmic domain

  • A single transmembrane helix that anchors it to the inner membrane

  • A large C-terminal periplasmic domain (19.2 kDa, 163 amino acids)

This structural arrangement makes T unique among holins, which typically consist of two or more transmembrane domains linked by short loops . The periplasmic domain contains two highly conserved cysteine residues (Cys175 and Cys207) that form intramolecular disulfide bonds critical for protein function .

How does T4 lysis protein interact with other phage proteins in the lysis pathway?

T4 lysis protein interacts directly with the RI antiholin protein to regulate the timing of host cell lysis. When RI is activated (typically in response to superinfection), it binds to the periplasmic domain of T, forming a heterodimeric complex that inhibits T's hole-forming function, thereby preventing premature lysis . Analytical centrifugation and gel filtration analyses indicate that this interaction produces a complex of equimolar T and RI content, with the predominant species being a heterodimer (though higher-order structures can form) . This interaction between the soluble periplasmic domains of these two proteins is necessary and sufficient for lysis inhibition, highlighting the elegant regulatory mechanism that phage T4 has evolved to maximize progeny production .

What are the most effective expression systems for producing recombinant T4 lysis protein for structural studies?

For structural studies of T4 lysis protein, researchers should consider using specialized expression systems that allow disulfide bond formation, given the critical importance of conserved cysteine residues. The most effective approach involves:

  • Using modified host strains such as Origami™ (Novagen) or SHuffle® (NEB) that allow disulfide bond formation in the cytoplasm

  • Expressing the periplasmic domain separately (without the transmembrane domain) to improve solubility

  • Adding a cleavable purification tag (His6 or GST) at the N-terminus for simplified purification

  • Employing controlled, low-temperature induction (16-18°C) to reduce protein aggregation

When studying the full-length protein, consider using fusion partners like alkaline phosphatase or OmpA fragments to verify membrane integration and topology . These approaches have successfully identified T as an integral membrane protein present as a homooligomer in the plasma membrane .

What purification challenges exist for T4 lysis protein and how can they be addressed?

Purification of T4 lysis protein presents several challenges due to its propensity to oligomerize and precipitate at high concentrations . Researchers can address these challenges through:

  • Prevention of aggregation:

    • Include mild detergents (0.1% n-dodecyl-β-D-maltoside) throughout purification

    • Maintain glycerol (10-15%) in all buffers to enhance stability

    • Use reducing agents cautiously, as disulfide bonds are essential for function

  • Purification strategy:

    • Begin with affinity chromatography using a cleavable tag

    • Follow with ion exchange chromatography to remove contaminants

    • Complete with size exclusion chromatography at low protein concentrations (< 0.5 mg/ml)

    • Consider co-purifying with the RI antiholin to stabilize T, as studies have shown that RI binding inhibits aggregation of T

  • Storage conditions:

    • Store at concentrations below 0.5 mg/ml to prevent precipitation

    • Add 10% glycerol and flash-freeze in liquid nitrogen

    • Store at -80°C in small aliquots to avoid freeze-thaw cycles

What techniques are most reliable for studying T4 lysis protein-membrane interactions?

For investigating T4 lysis protein-membrane interactions, researchers should consider:

  • Fluorescence-based techniques:

    • FRET (Förster Resonance Energy Transfer) between labeled T and membrane dyes

    • Single-molecule tracking to analyze dynamics within membranes

    • GFP fusions to track localization patterns during infection

  • Biophysical methods:

    • Atomic Force Microscopy (AFM) to visualize membrane perturbations

    • Electrophysiology to measure pore formation in artificial membranes

    • Surface Plasmon Resonance (SPR) to quantify binding kinetics to lipid layers

  • Biochemical approaches:

    • Membrane floatation assays to assess membrane association

    • Crosslinking studies to capture transient interactions

    • Protease protection assays to determine topology

  • Artificial membrane systems:

    • Liposomes of defined composition to study selectivity of membrane binding

    • Giant Unilamellar Vesicles (GUVs) to visualize pore formation

    • Nanodiscs to isolate and study T in a membrane environment

Research has demonstrated that T is an integral membrane protein that forms homooligomeric complexes . These techniques can help elucidate the precise mechanism by which T transitions from an inactive to an active pore-forming state.

Which amino acid residues are critical for T4 lysis protein function, and how should mutagenesis studies be designed?

Critical residues in T4 lysis protein include:

  • Conserved cysteine residues:

    • Cys175 and Cys207 in the periplasmic domain are essential for function

    • Single and double Ser substitutions (Cys175Ser, Cys207Ser, Cys175/207Ser) result in complete loss of lytic function

  • Transmembrane domain residues:

    • Conservative mutations in the TMD can dramatically affect triggering time

    • Specific residues facilitating oligomerization are key targets for mutagenesis

For effective mutagenesis studies:

  • Site-directed mutagenesis approach:

    • Use alanine-scanning for initial identification of functional regions

    • Follow with conservative substitutions to fine-tune understanding

    • Employ cysteine-scanning accessibility methods to map pore-lining residues

  • Phenotypic analysis:

    • Monitor lysis timing in synchronized infections

    • Quantify holin accumulation via Western blotting

    • Assess membrane permeabilization using fluorescent dyes

  • Comparative analysis:

    • Design mutations based on sequence conservation among T4-like phages

    • Focus on residues conserved across diverse T4-like phages

    • Consider the spacing between key residues, which is often highly conserved

  • Complementation testing:

    • Test mutants for their ability to complement T4 t-defective phages

    • Assess dominance in mixed infections with wild-type phage

How do mutations in the T4 lysis protein relate to the rapid-lysis (r) phenotype?

The rapid-lysis (r) phenotype in phage T4 is characterized by the production of distinctly large, sharp-edged plaques and the inability to conduct lysis inhibition (LIN) . Mutations in the T4 lysis protein (T) are directly linked to this phenotype through the following relationships:

  • T gene (rV) mutations:

    • The T4 lysis protein gene is also known as rV

    • Mutations in rV lead to a rapid lysis phenotype by affecting the ability of the holin to respond to RI-mediated inhibition

    • These mutants typically lyse the host cell prematurely, resulting in reduced burst size (approximately 10^9 virions/ml compared to 10^11 virions/ml in wild-type infections)

  • Mechanistic basis:

    • Mutations likely alter the binding interface between T and RI

    • Some mutations may cause T to oligomerize prematurely, bypassing RI control

    • Others may affect the timing mechanism inherent to holin function

  • Experimental approach to r-phenotype analysis:

    • Compare plaque morphology between wild-type and mutant phages

    • Measure lysis timing in synchronized infections with and without superinfection

    • Quantify burst size differences between wild-type and r mutants

    • Analyze the ability of the mutant T protein to respond to RI in reconstituted systems

This relationship between T mutations and the r phenotype highlights the central role of T in regulating the lysis timing in response to environmental cues, particularly the density of uninfected host cells in the vicinity.

What is the role of disulfide bonds in T4 lysis protein function, and how can their formation be studied?

Disulfide bonds play a critical role in T4 lysis protein function as evidenced by:

  • Conservation and essentiality:

    • The two cysteine residues (Cys175 and Cys207) are conserved in number, spacing (30-31 intervening residues), and position (C-terminal 20%) across T4-like phages

    • Substitution of either or both cysteines with serine results in complete loss of lytic function

  • Structural contribution:

    • Disulfide bonds likely stabilize the tertiary structure of the periplasmic domain

    • They may be essential for proper folding and/or maintenance of a conformation required for oligomerization or interaction with RI

To study disulfide bond formation in T4 lysis protein:

  • Biochemical analysis:

    • Compare migration patterns on non-reducing versus reducing SDS-PAGE

    • Use alkylating agents like iodoacetamide to trap free thiols

    • Employ mass spectrometry to map disulfide connectivity

  • Expression systems:

    • Use specialized strains like Origami™ that facilitate disulfide bond formation in the cytoplasm

    • Compare protein activity when produced in oxidizing versus reducing environments

  • Structural studies:

    • Apply circular dichroism spectroscopy to assess secondary structure changes upon reduction

    • Use FRET with labeled cysteines to measure conformational changes

    • Apply computational approaches like AlphaFold2 to predict disulfide bond contributions to structure

  • Functional assessment:

    • Test the activity of proteins with engineered disulfide bonds at alternative positions

    • Examine phenotypes of phage carrying non-conservative substitutions at cysteine positions

    • Investigate the kinetics of disulfide bond formation during infection

How does T4 lysis protein interact with the RI antiholin to achieve lysis inhibition?

The interaction between T4 lysis protein and the RI antiholin is a sophisticated example of protein-based regulation that controls phage lysis timing:

  • Structural basis:

    • The periplasmic domain of T (19.2 kDa) interacts directly with the periplasmic domain of RI (8.8 kDa)

    • RI is targeted to the periplasm by a cleavable signal peptide (SAR domain)

    • The complex forms with equimolar stoichiometry, predominantly as a heterodimer

  • Biochemical characteristics:

    • RI is monomeric with ~80% alpha-helical content

    • T exhibits propensity to oligomerize and precipitate at high concentrations

    • RI binding to T inhibits this aggregation, suggesting that RI stabilizes T in a pre-hole conformation

  • Functional consequences:

    • RI binding prevents T from forming lethal holes in the inner membrane

    • This interaction extends the infection cycle indefinitely if superinfections continue to occur at <10 min intervals

    • The extended cycle allows virions to accumulate intracellularly to levels ten-fold or more higher than the normal burst size

  • Molecular stoichiometry:

    • In LIN-inhibited cells, ~8000 molecules of T accumulate by 60 minutes post-infection

    • The critical concentration for T triggering is ~4000 molecules

    • RI is present at low levels (fewer than 10,000 molecules per cell), suggesting high-affinity binding

This interaction represents a real-time regulation system that responds to environmental conditions, specifically the availability of uninfected host cells in the vicinity, and maximizes phage progeny production under crowded infection conditions.

What techniques are most effective for studying the T-RI complex formation in vitro?

To effectively study T-RI complex formation in vitro, researchers should consider the following approaches:

  • Biophysical characterization:

    • Analytical ultracentrifugation to determine complex size and stoichiometry

    • Circular dichroism spectroscopy to analyze secondary structure changes upon binding

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to determine binding kinetics

  • Structural analysis:

    • X-ray crystallography of co-purified complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for mapping interaction interfaces

    • Computational prediction using tools like AlphaFold2

  • Biochemical approaches:

    • Co-immunoprecipitation with antibodies against either protein

    • Pull-down assays with tagged versions of T or RI

    • Crosslinking studies to capture transient interactions

    • Gel filtration chromatography to analyze complex formation and stability

  • Fluorescence-based methods:

    • FRET between labeled T and RI to detect binding in real-time

    • Fluorescence polarization to measure binding affinities

    • Single-molecule tracking to observe complex dynamics

Research has shown that incubation of purified RI with T inhibits the aggregation of T and results in a complex of equimolar T and RI content . While gel filtration suggests a complex mass of 45 kDa (between the predicted 30 kDa heterodimer and 60 kDa heterotetramer), sedimentation velocity analysis indicates the predominant species is the heterodimer .

How can researchers quantify T4 lysis protein levels during phage infection?

Accurate quantification of T4 lysis protein levels during infection is crucial for understanding the dynamics of lysis regulation. Researchers can employ the following methods:

  • Western blotting techniques:

    • Quantitative Western blotting with purified protein standards

    • Sampling directly into ice-cold TCA for rapid and quantitative denaturation of all cell proteins

    • Using antibodies previously raised against the periplasmic domain of T

  • Sample preparation considerations:

    • Synchronous infection conditions (MOI = 10)

    • Sampling at defined timepoints post-infection

    • Comparison between wild-type T4 and r mutant infections

  • Quantification analysis:

    • Densitometry against known standards

    • Normalization to cell density at time of sampling

    • Comparison with other phage proteins (like the endolysin) as internal controls

  • Advanced techniques:

    • Fluorescent reporter fusions for real-time monitoring

    • Mass spectrometry-based quantification (MRM/SRM approaches)

    • Single-cell analysis techniques to account for infection heterogeneity

Research has determined that under LIN conditions, approximately 8,000 molecules of T accumulate by 60 minutes post-infection, while in non-LIN conditions (T4 rI- infection), approximately 4,000 molecules accumulate by 30 minutes, representing the critical concentration for T triggering . These quantities are comparable to levels observed for other holin proteins, such as lambda S and phage 21 S68 .

How can the T4 lysis system be reconstituted in Escherichia coli for functional studies?

Reconstitution of the T4 lysis system in E. coli provides a controlled environment for studying lysis regulation. An effective approach includes:

  • Minimal reconstitution system:

    • Express only the three essential T4 components: holin T, antiholin RI, and T4 lysozyme

    • Use separate compatible vectors with different inducible promoters for independent control

    • Ensure proper targeting of RI to the periplasm using its native signal sequence

  • Expression vector design:

    • Place the t gene under an inducible promoter (IPTG or arabinose)

    • Express rI from a compatible plasmid with an orthogonal inducer

    • Include the T4 lysozyme (e) gene to complete the lysis system

    • Add appropriate tags for detection without compromising function

  • Induction protocols:

    • Establish synchronous culture conditions

    • Induce expression at precise optical densities

    • Monitor lysis by measuring culture turbidity over time

    • Compare lysis timing between different construct combinations

  • Analytical approaches:

    • Western blotting to confirm expression levels

    • Fluorescence microscopy to visualize cell morphology changes

    • Live/dead staining to quantify lysis efficiency

    • Electron microscopy to examine membrane integrity

This approach is simpler than using complete phages or the lambda lysis cassette with T4 components, avoiding the complexity of additional lambda genes . Such reconstitution systems have successfully been used to examine the functional roles of specific amino acids in both RI and T proteins .

What are the advantages and limitations of different host systems for studying T4 lysis protein function?

Different host systems offer distinct advantages and limitations for studying T4 lysis protein function:

  • E. coli B strains (natural T4 hosts):

    Advantages:

    • Natural host environment for T4 infection

    • Complete complement of host factors that may influence lysis

    • Authentic membrane composition and cell envelope structure

    Limitations:

    • Complex background of phage-host interactions

    • Difficult to isolate specific protein functions

    • Limited genetic manipulation options

  • E. coli K-12 laboratory strains:

    Advantages:

    • Well-characterized genetics

    • Extensive molecular biology tools available

    • Compatible with T4 infection and protein expression

    • Allows controlled expression of individual components

    Limitations:

    • May have subtle differences in membrane composition

    • Some strains have restriction systems that can affect T4 DNA

  • Specialized expression strains:

    Advantages:

    • Origami™ or SHuffle® strains facilitate disulfide bond formation

    • BL21(DE3) provides high-level protein expression

    • C41/C43 strains better tolerate membrane protein expression

    Limitations:

    • May not reflect natural infection conditions

    • Can have growth defects that complicate interpretation

  • In vitro systems:

    Advantages:

    • Highly controlled biochemical environment

    • Ability to manipulate individual components

    • Direct measurement of specific interactions

    Limitations:

    • May not capture the complexity of the cellular environment

    • Artificial membrane systems don't fully replicate bacterial membranes

For complete functional studies, researchers often employ a combination of these systems, starting with in vitro biochemical characterization, followed by controlled expression in laboratory strains, and validation in natural host strains during actual phage infection.

How can researchers distinguish between direct effects of T4 lysis protein mutations and indirect effects on other phage proteins?

Distinguishing direct effects of T4 lysis protein mutations from indirect effects on other phage components requires careful experimental design:

  • Minimal reconstitution systems:

    • Express the T protein and its variants in isolation from other phage proteins

    • Use compatible plasmids to systematically add other components (RI, lysozyme)

    • Compare phenotypes between the minimal system and complete phage infection

  • Complementation analysis:

    • Test if wild-type T can complement mutations in other r genes

    • Determine if mutant T can be complemented by wild-type versions of other proteins

    • Use amber mutations in t and other genes to control expression

  • Protein-protein interaction studies:

    • Compare binding properties of wild-type and mutant T to RI and other partners

    • Use pull-down assays, SPR, or FRET to quantify interaction differences

    • Assess whether mutations in T affect localization or stability of other proteins

  • Timing analysis:

    • Measure protein accumulation kinetics for T and other phage proteins

    • Compare lysis timing between different mutant combinations

    • Determine if effects on lysis timing correlate with direct biochemical effects

  • Domain swapping:

    • Create chimeric proteins between T and other holins (like lambda S)

    • Map functional domains through systematic exchanges

    • Identify regions specifically affecting interaction with RI versus intrinsic holin function

These approaches help separate the intrinsic effects of T mutations on its own function from secondary effects on other components of the lysis system. The r gene mutational spectrum analysis has been valuable in relating mutational effects to the physiologies of the encoded proteins .

What computational tools are most effective for predicting T4 lysis protein structure and interactions?

Modern computational tools offer powerful approaches for predicting T4 lysis protein structure and interactions:

  • Structure prediction:

    • AlphaFold2/ColabFold has revolutionized protein structure prediction and can model the T protein with high confidence

    • RoseTTAFold provides alternative predictions for validation

    • SWISS-MODEL allows homology modeling based on known structures

    • Molecular dynamics simulations can reveal dynamic properties of predicted structures

  • Interaction prediction:

    • Protein-protein docking (HADDOCK, ClusPro) to model T-RI complexes

    • AlphaFold-Multimer for predicting heterodimeric complexes

    • Molecular dynamics simulations to refine interaction interfaces

    • Coevolution analysis to identify residue pairs likely to interact

  • Sequence analysis tools:

    • BLASTP for identifying homologs across diverse phages

    • Clustal Omega for multiple sequence alignments

    • WebLogo for visualizing conservation at specific positions

    • ConSurf for mapping conservation onto structural models

  • Functional prediction:

    • TransMembrane prediction using Hidden Markov Models (TMHMM)

    • SignalP for signal peptide prediction

    • Mutational effect predictors (PROVEAN, SIFT) to prioritize residues for experimental validation

These computational approaches complement experimental studies by guiding hypothesis generation and experimental design. For instance, AlphaFold2 predictions could identify potential interaction surfaces between T and RI that can then be validated through targeted mutagenesis .

What are the most promising applications of understanding T4 lysis protein function for synthetic biology and biotechnology?

Understanding T4 lysis protein function offers several promising applications in synthetic biology and biotechnology:

  • Controlled cell lysis systems:

    • Engineered lysis switches for programmed cell death in synthetic circuits

    • Tunable lysis systems with adjustable kinetics based on T-RI interactions

    • Safety mechanisms for biocontainment of engineered organisms

  • Protein and metabolite production:

    • Controlled release of intracellular products without harsh chemical extraction

    • Enhancement of protein secretion through sublethal membrane permeabilization

    • Timed lysis for harvesting sensitive biomolecules

  • Antimicrobial development:

    • Design of synthetic holins as novel antibacterials

    • Engineering phage cocktails with optimized lysis timing

    • Creation of membrane-disrupting peptides based on T functional domains

  • Diagnostic tools:

    • Reporter systems based on conditional lysis

    • Detection of specific bacterial pathogens using engineered phage lysis systems

    • Biosensors that trigger lysis in response to environmental signals

  • Fundamental research tools:

    • Probes for studying bacterial membrane organization

    • Models for membrane protein assembly and oligomerization

    • Systems for investigating protein translocation mechanisms

The unique properties of T4 lysis protein—including its single transmembrane domain, large periplasmic domain, and regulatory interactions—make it an attractive component for synthetic biology applications requiring precise control over membrane integrity and cell viability.

How can researchers effectively combine structural biology with functional genomics to advance understanding of T4 lysis regulation?

Integrating structural biology with functional genomics provides powerful insights into T4 lysis regulation:

  • Structural biology approaches:

    • Cryo-EM to visualize T in membrane environments

    • X-ray crystallography of the T-RI complex

    • NMR studies of domain dynamics and interactions

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to map binding interfaces

  • Functional genomics strategies:

    • Deep mutational scanning of both T and RI

    • CRISPR interference screening to identify host factors

    • RNA-seq to characterize transcriptional responses

    • Proteomics to identify interaction partners during infection

  • Integration methods:

    • Map mutational effects onto structural models

    • Correlate evolutionary conservation with structural features

    • Design structure-guided mutations for functional testing

    • Use molecular dynamics to simulate effects of mutations

  • Experimental validation pipeline:

    • Generate structure-based hypotheses

    • Test with targeted mutagenesis

    • Validate with biochemical and cellular assays

    • Refine structural models based on functional data

  • Advanced genetic approaches:

    • PACE (Phage-Assisted Continuous Evolution) to evolve T variants with altered properties

    • Suppressor mutation analysis to identify functional relationships

    • Synthetic genetic arrays to map genetic interactions

This integrated approach has already yielded insights into the functional importance of conserved cysteine residues in T and the formation of T-RI heterodimers . Future work combining AlphaFold2 structure predictions with deep mutational scanning could rapidly advance understanding of the molecular mechanisms underlying lysis regulation in phage T4.

What are the most common pitfalls in studying T4 lysis protein, and how can they be avoided?

Researchers studying T4 lysis protein frequently encounter these challenges:

  • Protein instability and aggregation:

    • Problem: T exhibits a propensity to oligomerize and precipitate at high concentrations

    • Solution: Maintain low protein concentrations (<0.5 mg/ml), include stabilizing agents like glycerol, and consider co-expression with RI to stabilize the protein

  • Disulfide bond formation:

    • Problem: Improper disulfide bond formation leads to non-functional protein

    • Solution: Use specialized expression strains that facilitate disulfide bond formation in the cytoplasm, such as Origami™

  • Membrane integration assessment:

    • Problem: Confirming proper membrane insertion and topology is challenging

    • Solution: Use reporter fusions like alkaline phosphatase or OmpA fragments, and employ protease protection assays

  • Distinguishing T effects from other r genes:

    • Problem: Multiple r genes influence lysis timing through different mechanisms

    • Solution: Use minimal reconstitution systems with only T, RI, and lysozyme to isolate specific effects

  • Variable lysis timing:

    • Problem: Lysis timing can be highly variable between experiments

    • Solution: Ensure precise synchronization of cultures, standardize induction conditions, and use automated turbidity measurements

  • Antibody specificity:

    • Problem: Cross-reactivity with host proteins can complicate Western blot analysis

    • Solution: Validate antibodies against purified proteins and include appropriate controls including T-deficient phage infections

  • Membrane extraction efficiency:

    • Problem: Incomplete membrane extraction leads to variable recovery

    • Solution: Optimize detergent conditions and use multiple extraction methods for comparison

By anticipating these challenges and implementing the suggested solutions, researchers can improve the reliability and reproducibility of their studies on T4 lysis protein.

How can researchers overcome challenges in detecting and quantifying low-abundance T4 lysis proteins during infection?

Detection and quantification of low-abundance T4 lysis proteins during infection require specialized approaches:

  • Sample preparation optimization:

    • Direct sampling into ice-cold TCA for instantaneous denaturation and preservation of proteins

    • Concentration of samples through TCA precipitation

    • Synchronous infection at high MOI (≥10) to maximize protein production

    • Collection of large sample volumes for low-abundance proteins

  • Enhanced detection methods:

    • Highly sensitive chemiluminescent or fluorescent Western blot substrates

    • Sandwich ELISA with multiple epitope recognition

    • Selected Reaction Monitoring (SRM) mass spectrometry for targeted quantification

    • Proximity ligation assays for detecting protein-protein interactions

  • Signal amplification strategies:

    • Two-step immunological detection with biotinylated secondary antibodies

    • Tyramide signal amplification for Western blots

    • Poly-HRP conjugated antibodies for enhanced sensitivity

    • Quantum dots as fluorescent labels for improved signal-to-noise ratio

  • Quantification approaches:

    • Standard curves using purified recombinant proteins

    • Digital PCR for mRNA quantification as a proxy for protein production

    • Internal standards for normalization between samples

    • Biological replicates to account for infection variability

  • Genetic approaches:

    • Epitope tagging at non-essential positions

    • Fluorescent protein fusions for microscopy-based detection

    • Inducible overexpression to establish detection limits

Research has shown that even with these sensitive methods, proteins like RI may still be undetectable in some settings, requiring careful experimental design and controls to establish detection limits (estimated at <10,000 molecules per cell for RI) .

What strategies can researchers use to distinguish between different oligomeric states of T4 lysis protein?

Distinguishing between different oligomeric states of T4 lysis protein requires a combination of complementary techniques:

  • Size-based separation methods:

    • Size exclusion chromatography to separate different oligomeric forms

    • Native PAGE to visualize discrete oligomeric species

    • Analytical ultracentrifugation for precise determination of molecular weights

    • Field-flow fractionation for gentle separation of large complexes

  • Biophysical characterization:

    • Dynamic light scattering to measure size distributions

    • Multi-angle light scattering (MALS) coupled with SEC for absolute molecular weight determination

    • Small-angle X-ray scattering (SAXS) to characterize oligomer sizes and shapes

    • Analytical ultracentrifugation with sedimentation velocity analysis to distinguish between oligomeric states

  • Chemical crosslinking approaches:

    • Concentration-dependent crosslinking to capture transient oligomers

    • Mass spectrometry of crosslinked samples to identify interaction interfaces

    • Time-course crosslinking to monitor oligomerization kinetics

    • In vivo crosslinking during infection to capture native states

  • Microscopy techniques:

    • Single-molecule fluorescence for counting subunits

    • Atomic force microscopy to visualize membrane-embedded oligomers

    • Cryo-electron microscopy for high-resolution structural analysis

  • Functional assessment:

    • Correlation of oligomeric state with pore-forming activity

    • Mutational analysis targeting oligomerization interfaces

    • Comparison of oligomeric states in the presence and absence of RI

Research has demonstrated that T exhibits a propensity to oligomerize and precipitate at high concentrations, while incubation with RI inhibits this aggregation . Additionally, while gel filtration analysis indicated a T-RI complex mass of 45 kDa (intermediate between the predicted 30 kDa heterodimer and 60 kDa heterotetramer), sedimentation velocity analysis indicated that the predominant species is the heterodimer .

How should researchers interpret contradictory results between in vitro and in vivo studies of T4 lysis protein?

When faced with contradictory results between in vitro and in vivo studies of T4 lysis protein, researchers should apply the following interpretive framework:

  • Consider environmental differences:

    • In vitro lacks the complex membrane environment and crowding effects

    • Protein concentrations in vitro often differ significantly from physiological levels

    • Native membrane composition affects protein folding and oligomerization

    • Solution conditions (pH, ionic strength) may not match periplasmic environment

  • Evaluate protein state:

    • Check if purified protein contains all post-translational modifications

    • Verify disulfide bond formation status (critical for T function)

    • Assess protein stability and aggregation state in vitro

    • Confirm proper folding using circular dichroism or other structural techniques

  • Examine interaction network completeness:

    • In vivo systems contain all potential binding partners

    • Host factors may mediate or modulate T function

    • Accessory phage proteins might affect T behavior

    • Membrane composition influences protein-lipid interactions

  • Reconciliation strategies:

    • Use reconstitution approaches of increasing complexity

    • Begin with purified components and progressively add complexity

    • Validate in vitro observations with targeted in vivo experiments

    • Develop quantitative models that account for differences in conditions

  • Technical considerations:

    • Different detection limits between methods

    • Time resolution of measurements

    • Population average versus single-cell measurements

    • Artifacts from protein tags or expression systems

For example, the critical concentration of T for triggering lysis in vivo is approximately 4,000 molecules per cell , but in vitro studies might show different thresholds for oligomerization or pore formation. These differences can provide insights into regulatory mechanisms rather than representing truly contradictory results.

What statistical approaches are most appropriate for analyzing T4 lysis timing data?

Analyzing T4 lysis timing data requires robust statistical approaches tailored to the specific experimental design:

  • Descriptive statistics:

    • Mean lysis time with standard deviation

    • Median lysis time with interquartile range (less sensitive to outliers)

    • Cumulative lysis curves showing population dynamics

    • Coefficient of variation to quantify timing precision

  • Comparative analyses:

    • Two-sample t-tests for comparing two conditions

    • ANOVA with post-hoc tests for multiple condition comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal distributions

    • Paired tests when comparing matched samples

  • Regression analyses:

    • Linear regression to identify relationships between variables

    • Multiple regression to account for confounding factors

    • Cox proportional hazards models for time-to-event data

    • Mixed-effects models for experiments with hierarchical structure

  • Time series analysis:

    • Growth curve fitting to extract lysis parameters

    • Change-point detection to identify lysis initiation

    • Autocorrelation analysis for identifying temporal patterns

    • Smoothing techniques to reduce measurement noise

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Blocking designs to control for batch effects

    • Randomization to prevent systematic bias

    • Technical and biological replicates to assess variability sources

For example, when comparing wild-type T4 infections (which establish LIN and lyse at ~60 minutes) with r mutant infections (which lyse at ~30 minutes) , researchers should account for both the mean timing difference and the variability in timing, as increased variability might indicate perturbation of regulatory mechanisms.

How can researchers effectively compare experimental results across different T4 strains and experimental conditions?

Effective comparison of results across different T4 strains and experimental conditions requires systematic approaches:

  • Normalization strategies:

    • Use relative measures (fold-change) rather than absolute values

    • Include standard control strains across experiments

    • Normalize to internal references (housekeeping genes, constitutive proteins)

    • Apply mathematical transformations to account for systematic differences

  • Standardized reporting:

    • Document detailed experimental conditions (strain backgrounds, media, temperature)

    • Report absolute MOI and cell density values

    • Include growth rates of host strains

    • Provide raw data alongside processed results

  • Meta-analysis approaches:

    • Effect size calculations to compare magnitudes across studies

    • Fixed or random effects models to account for inter-study variability

    • Forest plots to visualize results across multiple experiments

    • Sensitivity analysis to identify factors influencing outcomes

  • Experimental design for comparability:

    • Factorial designs to systematically vary conditions

    • Latin square approaches to efficiently test multiple factors

    • Split-plot designs when some factors are difficult to randomize

    • Include bridging conditions between experimental batches

  • Visualization techniques:

    • Parallel coordinate plots to visualize multivariate data

    • Heat maps for comparing multiple conditions simultaneously

    • Radar charts for multidimensional phenotype comparison

    • Interactive data exploration tools for complex datasets

For instance, when comparing results between wild-type T4 and r mutants, researchers should account for differences in infection conditions, host strain backgrounds, and measurement methods. Studies have shown that wild-type infections typically yield titers around 10^11 virions/ml, while r mutant infections yield approximately 10^9 virions/ml under comparable conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.