Recombinant Enterococcus faecalis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; EF_2612; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Enterococcus faecalis (strain ATCC 700802 / V583)
Target Names
atpF
Target Protein Sequence
MLLTTLVVGETAPSTTLGTMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSA EQSRVAAAKMEKERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKART DISQEREEALSSVKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESLGKANETR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembraneous) and the F0 membrane proton channel. These are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.
Database Links

KEGG: efa:EF2612

STRING: 226185.EF2612

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit b (atpF) in Enterococcus faecalis?

ATP synthase subunit b, encoded by the atpF gene, is a critical component of the F1Fo ATP synthase complex in E. faecalis. Based on comparative analysis with other bacterial systems, atpF forms part of the membrane-embedded Fo portion of the ATP synthase. The b subunit typically functions as part of the stator stalk that connects the Fo portion to the F1 portion, thereby stabilizing the complex during rotational catalysis.

Similar to the F1Fo complex characterized in Clostridium pasteurianum, the E. faecalis ATP synthase likely synthesizes ATP through chemiosmotic coupling, utilizing the energy of the transmembrane proton gradient. The b subunit is essential for maintaining proper structural integrity and functional coupling between the membrane-embedded proton channel and the catalytic sites .

How is the atpF gene organized within the ATP synthase operon in E. faecalis?

The organization of the ATP synthase operon in E. faecalis follows a pattern similar to that found in many other bacteria. Based on comparative genomics, the ATP synthase operon typically consists of nine genes arranged in the order atpI(i), atpB(a), atpE(c), atpF(b), atpH(δ), atpA(α), atpG(γ), atpD(β), and atpC(ε) .

The atpF gene encoding the b subunit is positioned in the middle of the operon, following genes for other Fo components (a and c subunits) and preceding genes for F1 components. This conserved arrangement facilitates coordinated expression of all components required for assembly of the functional ATP synthase complex .

What expression patterns of ATP synthase have been observed in E. faecalis under stress conditions?

E. faecalis demonstrates significant proteomic adaptations in ATP-related systems under various stress conditions. Under alkaline stress, proteins involved in ATP-binding cassette (ABC) transporters are significantly enriched. Studies have identified a total of 15 highly expressed ABC transporters in high alkaline environment pressure groups, with 7 proteins expressed at levels greater than 1.5 times normal expression .

Additionally, when exposed to bile acids, both E. faecalis and E. faecium show up-expression of various subunits of ATPases. These proteomic adaptations suggest a central role for ATP-related systems in bacterial stress responses, contributing to survival in hostile environments .

What methodologies are most effective for expression and purification of recombinant E. faecalis atpF protein?

Based on successful approaches with similar proteins, the following methodology is recommended for recombinant E. faecalis atpF:

Expression System:

  • Host: E. coli BL21(DE3) or similar expression strains

  • Vector: pET series vectors containing T7 promoter

  • Fusion tag: N-terminal His-tag (6x) for affinity purification

Expression Protocol:

  • Transform expression vector into E. coli

  • Culture in LB medium at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.5-1.0 mM IPTG

  • Shift temperature to 18-25°C for 16-18 hours to enhance soluble protein production

  • Harvest cells by centrifugation at 5,000 × g for 15 minutes

Purification Strategy:

  • Lyse cells using sonication or French press in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM PMSF

  • Clarify lysate by centrifugation at 20,000 × g for 30 minutes

  • Purify using Ni-NTA affinity chromatography with imidazole gradient elution

  • Perform size exclusion chromatography for further purification

  • Assess purity by SDS-PAGE (target >90% purity)

Storage Conditions:

  • Store at -20°C/-80°C as aliquots in buffer containing 50 mM Tris-HCl, pH 8.0, with 50% glycerol

  • Avoid repeated freeze-thaw cycles

How can researchers effectively analyze interactions between atpF and other ATP synthase subunits?

Multiple complementary techniques provide comprehensive insights into protein-protein interactions within the ATP synthase complex:

TechniqueMethodologyAdvantagesLimitations
Affinity pulldown assaysExpress His-tagged atpF, incubate with cell lysate, purify, and identify binding partners by MSIdentifies direct and indirect interactions in near-native conditionsMay detect non-physiological interactions
Chemical cross-linkingUse formaldehyde or targeted cross-linkers followed by MS analysisCaptures transient interactions in vivoCross-linking efficiency varies; may alter complex structure
Surface plasmon resonanceImmobilize purified atpF and measure binding kinetics with other purified subunitsProvides quantitative binding parameters (kon, koff, KD)Requires purified components; surface immobilization may affect interactions
Cryo-electron microscopyPurify intact ATP synthase complex and determine structureProvides structural context for interactions at near-atomic resolutionTechnically challenging; requires specialized equipment
Bacterial two-hybrid systemFuse atpF and potential partners to complementary fragments of a reporterDetects interactions in cellular contextMay produce false positives/negatives; fusion may affect function

As demonstrated in studies of other bacterial ATPases, combining these approaches provides the most comprehensive understanding of interactions. For instance, research on PrgJ (another ATPase in E. faecalis) employed both affinity pulldown assays and formaldehyde cross-linking to characterize protein-DNA and protein-protein interactions .

What site-directed mutagenesis approaches can be used to study critical functional domains in E. faecalis atpF?

Site-directed mutagenesis provides valuable insights into structure-function relationships. Based on studies of other bacterial ATPases, the following approach is recommended:

Target Selection Strategy:

  • Identify conserved residues through multi-sequence alignment of atpF across bacterial species

  • Focus on predicted functional domains:

    • Transmembrane regions

    • Stator stalk domains

    • Interface regions with other subunits

Experimental Approach:

  • Generate mutations using PCR-based site-directed mutagenesis

  • Express wild-type and mutant proteins in parallel

  • Purify proteins and assess structural integrity by circular dichroism

  • Perform functional assays comparing ATP synthesis/hydrolysis activities

  • Analyze assembly of the ATP synthase complex

Critical Domains to Target:

  • NTP binding sites (similar to the K471E mutation in PrgJ that abolished ATP hydrolysis)

  • Residues involved in oligomerization

  • Membrane interaction surfaces

  • Interface regions with F1 components

Mutations should be designed to test specific hypotheses about domain function, such as conservative substitutions to test chemical properties versus structural roles of specific residues.

How does E. faecalis ATP synthase contribute to biofilm formation and antimicrobial resistance?

ATP synthase plays multifaceted roles in biofilm formation and antimicrobial resistance:

Energy Provision for Biofilm Processes:

  • ATP production supports extracellular polymeric substance synthesis

  • Energizes active transporters involved in nutrient acquisition in biofilm state

  • Powers molecular machinery required for cell-cell communication

Stress Response and Adaptation:

  • Under alkaline stress (pH 10) and exposure to NaOCl (common endodontic disinfectant), E. faecalis biofilms show significant changes in protein expression profiles

  • ATP-binding cassette (ABC) transporters are significantly enriched in these conditions

  • These transporters require ATP for functioning and contribute to antimicrobial efflux

Experimental Approaches:

  • Generate conditional atpF mutants and assess biofilm formation capacity

  • Use ATP synthase inhibitors to evaluate impact on established biofilms

  • Perform comparative proteomics of planktonic vs. biofilm cells

  • Analyze biofilm tolerance to antimicrobials in relation to ATP synthase activity

Research has demonstrated that E. faecalis biofilms frequently persist on failed treated root canal walls by resisting disinfectants during endodontic treatment. Understanding ATP synthase's role in this persistence could lead to more effective treatment strategies .

What are the challenges in functional reconstitution of recombinant E. faecalis ATP synthase?

Reconstituting functional ATP synthase presents several technical challenges:

Membrane Protein Complexities:

  • The b subunit (atpF) contains hydrophobic domains that complicate expression and purification

  • Proper folding and assembly require specific membrane environments

  • Heterologous expression systems may lack necessary chaperones

Multi-subunit Assembly:

  • ATP synthase requires coordinated assembly of multiple subunits

  • Studies with C. pasteurianum showed that hybrid F1Fo complexes with E. coli components bound to each other but were not functionally active

  • This suggests species-specific co-evolution of components that may affect reconstitution

Methodological Approaches:

  • Co-expression of multiple ATP synthase subunits

  • Use of membrane-mimetic systems:

    • Nanodiscs

    • Liposomes

    • Detergent micelles

  • Stepwise assembly and functional verification

  • Activity assays under various conditions to assess functionality

Verifying Functional Activity:

  • ATP synthesis assays using pH gradients in proteoliposomes

  • ATP hydrolysis measurements with colorimetric phosphate detection

  • Proton pumping assays using pH-sensitive fluorescent dyes

How can proteomics approaches be optimized to study post-translational modifications of ATP synthase in E. faecalis?

Post-translational modifications (PTMs) can significantly impact ATP synthase function. Optimized proteomic approaches include:

Sample Preparation:

  • Fractionate bacterial cells to enrich membrane proteins

  • Use specialized extraction protocols for membrane proteins

  • Employ multiple proteases beyond trypsin (e.g., chymotrypsin, Glu-C) to improve sequence coverage

PTM Enrichment Strategies:

  • Phosphopeptide enrichment using:

    • Titanium dioxide (TiO2)

    • Immobilized metal affinity chromatography (IMAC)

  • Glycopeptide enrichment using lectins

  • Redox modification enrichment with thiol-reactive reagents

Mass Spectrometry Approaches:

  • Use data-independent acquisition mass spectrometry (DIA-MS) as demonstrated in studies of E. faecalis under bile acid stress

  • Employ parallel reaction monitoring (PRM) for targeted analysis of modified peptides

  • Implement electron transfer dissociation (ETD) fragmentation to preserve labile modifications

Bioinformatic Analysis:

  • Use specialized algorithms for PTM site localization

  • Implement statistical approaches to distinguish biological PTMs from artifacts

  • Map modifications to protein structure to infer functional significance

Recent studies employed LC-MS/MS-based label-free quantitative proteomics to compare differential protein expression in E. faecalis under environmental stresses, providing a methodological foundation for PTM analysis .

What approaches can reveal the evolutionary adaptations of ATP synthase in E. faecalis compared to other bacterial species?

Understanding evolutionary adaptations requires integrated comparative approaches:

Sequence Analysis:

  • Perform phylogenetic analysis of ATP synthase subunits across bacterial phyla

  • Identify lineage-specific signatures in E. faecalis ATP synthase

  • Calculate selection pressures (dN/dS) on different domains

Structural Comparisons:

  • Generate homology models based on solved structures

  • Compare conservation patterns in functional domains

  • Identify E. faecalis-specific structural features

Functional Characterization:

  • Compare biochemical properties:

    • pH optima

    • Temperature sensitivity

    • Ion specificity (H+ vs. Na+)

  • Assess distinctive regulatory mechanisms

  • Evaluate stress response adaptations

Cross-species Functional Studies:

  • Create chimeric ATP synthases with subunits from different species

  • Test functional compatibility between components

  • Identify determinants of species-specific properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.