Recombinant Enterococcus faecalis Magnesium transporter mgtE (mgtE)

Shipped with Ice Packs
In Stock

Description

Overview of Magnesium Transporters in Enterococcus faecalis

Enterococcus faecalis is a Gram-positive opportunistic pathogen with complex metal homeostasis systems critical for survival and virulence. While manganese (Mn) uptake systems (e.g., EfaCBA, MntH1, and MntH2) are well-characterized in E. faecalis , magnesium (Mg) transporters remain less studied in this organism. Notably, no direct evidence for a magnesium transporter named "MgtE" in E. faecalis exists in the current literature.

  • MntE (OG1RF_10589) in E. faecalis is a manganese/iron exporter, not a Mg transporter .

  • Mg²⁺ may indirectly offset Mn toxicity by competing for transport or binding sites .

Table 1: Characterized Transporters in E. faecalis

TransporterFunctionSubstrateMutant PhenotypeRelevance to Virulence
EfaCBAABC-type permeaseMn²⁺Severe growth defects in Mn-restricted conditions; reduced virulence in endocarditis and CAUTI models Essential for Mn acquisition during infection
MntH1/MntH2NRAMP transportersMn²⁺Redundant roles; triple ΔefaΔmntH1ΔmntH2 mutants lose >95% cellular Mn Critical for growth in serum/urine
MntEExporterMn²⁺/Fe²⁺Accumulates excess Mn/Fe; growth restriction under metal overload Detoxifies Mn/Fe to prevent toxicity

Table 2: Comparative Analysis of MgtE in Other Species vs. E. faecalis

OrganismTransporterFunctionCitation
Pseudomonas aeruginosaMgtEMg²⁺ uptake and virulence regulation
Enterococcus faecalisMntEMn²⁺/Fe²⁺ efflux

Recombinant Protein Engineering in E. faecalis

While MgtE has not been studied in E. faecalis, recombinant systems for protein expression in this organism are well-developed:

  • pCIE Vector: Uses a pheromone-responsive promoter for tightly regulated gene expression, validated for toxin-antitoxin studies .

  • pAGEnt Vector: Inducible by agmatine, enabling His-tagged protein overexpression .

Unexplored Aspects and Future Directions

  1. Genetic Screening: No mgtE homolog has been annotated in E. faecalis genomes, including strain OG1RF .

  2. Functional Redundancy: Mg²⁺ may rely on secondary transport systems or compete with Mn²⁺/Fe²⁺ pathways .

  3. Therapeutic Targets: Mn acquisition systems (e.g., EfaCBA) are prioritized for antimicrobial development due to their essentiality in infection .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mgtE; EF_2668; Magnesium transporter MgtE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Enterococcus faecalis (strain ATCC 700802 / V583)
Target Names
mgtE
Target Protein Sequence
MNEGQEMEEQFALLLETLKNQQMNEFRELFLALHIYEQGQFYQSLDEKDRQHLYNYLSPK ELADMFDVIEEDNENMKDYLAEMRPSYAADMLAEMYTDNAVDLLNMLDKSQKAKYLSLLS SEEAGEIKELLHYEDETAGAIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQ ENHLVGVISLRDLIVNDDDTLIADILNERVISVHVGDDQEDVAQTIRDYDFLAVPVTDYD DHLLGIVTVDDIIDVIDDEAASDYSGLAGVDVEEVSENPLKAASKRLPWLITLLFLGMST ASLISNYESLVSEASILAVFISLITGTAGNAGTQSLAVAVRRLAMKDEKDSNFGRLILSE VLTGLVTGAVTGLTIMIVVGVWQHNLPLGFVIGMAMLCAITVANLAGSLIPMLMDKLGFD PAVASGPFITTLSDLTSVLIYFNIASMFMRYFV
Uniprot No.

Target Background

Function
Functions as a magnesium transporter.
Database Links

KEGG: efa:EF2668

STRING: 226185.EF2668

Protein Families
SLC41A transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the MgtE magnesium transporter in E. faecalis?

The MgtE magnesium transporter in Enterococcus faecalis is a membrane protein consisting of both transmembrane and cytosolic domains. The cytosolic portion (residues 6-262) has been crystallized and its structure determined at 2.2 Å resolution. This cytosolic domain is structurally similar to the corresponding domain in Thermus thermophilus MgtE. The protein functions as a constitutively active transporter that facilitates magnesium movement from the periplasm to the cytoplasm, unlike ATP-dependent transporters such as MgtA and MgtB that require energy input. The cytosolic domain likely plays a regulatory role in sensing intracellular magnesium levels and controlling channel opening and closing in response to cellular magnesium concentrations .

What advanced techniques are used to determine MgtE protein conformational changes upon magnesium binding?

Researchers employ multiple complementary techniques to elucidate the conformational dynamics of MgtE upon magnesium binding:

  • X-ray crystallography at high resolution (2.2 Å or better) to capture static structures in different bound states

  • Cryo-electron microscopy to visualize the full-length transporter in native-like lipid environments

  • Hydrogen-deuterium exchange mass spectrometry to map regions that undergo conformational changes

  • FRET (Förster resonance energy transfer) with strategically placed fluorophores to monitor real-time conformational changes

  • Molecular dynamics simulations to model the transition between magnesium-bound and unbound states

  • Site-directed spin labeling coupled with electron paramagnetic resonance spectroscopy to measure distances between specific residues during conformational changes

These approaches collectively provide a comprehensive understanding of how magnesium binding at the four identified sites triggers structural rearrangements that ultimately lead to channel opening or closing .

What are the optimal conditions for expressing recombinant E. faecalis MgtE in heterologous systems?

The optimal expression of recombinant E. faecalis MgtE requires careful consideration of several parameters. For bacterial expression systems, using E. coli BL21(DE3) with the pET expression system typically yields good results. The expression should be induced at mid-log phase (OD600 of 0.6-0.8) with 0.2-0.5 mM IPTG. Lower induction temperatures (16-20°C) for longer periods (16-20 hours) often improve the yield of properly folded protein compared to standard conditions (37°C for 3-4 hours). For the full-length protein containing transmembrane domains, membrane-targeted expression systems with fusion tags (such as MBP or SUMO) can enhance solubility and proper folding. The cytosolic domain alone can be expressed with a His-tag for simplified purification. Expression media should be supplemented with 5-10 mM MgCl₂ to ensure proper folding of this magnesium-dependent protein. Oxygen levels should be carefully controlled as high oxygen tension can negatively impact protein folding due to oxidation of cysteine residues potentially involved in structural integrity .

What purification challenges are specific to recombinant E. faecalis MgtE and how can they be overcome?

Purification of recombinant E. faecalis MgtE presents several challenges that require specific strategies:

  • Membrane protein solubilization: For full-length MgtE, carefully selected detergents are crucial. A combination of initial solubilization with stronger detergents (1% DDM or LDAO) followed by exchange to milder detergents (0.03-0.05% DDM, LMNG, or GDN) during purification preserves protein structure and function.

  • Protein aggregation: Maintaining adequate magnesium concentrations (2-5 mM MgCl₂) in all purification buffers is essential to prevent aggregation, as MgtE undergoes conformational changes in magnesium-depleted conditions.

  • Proteolytic degradation: Adding protease inhibitor cocktails and maintaining low temperatures (4°C) throughout purification minimizes degradation. Working quickly and using freshly prepared samples improves results.

  • Protein heterogeneity: Size exclusion chromatography as a final purification step separates properly folded oligomeric states from aggregates and degradation products.

  • Low yield: Initial affinity purification using immobilized metal affinity chromatography with a His-tag, followed by tag removal and a second affinity step, significantly improves purity while maintaining reasonable yields.

The table below summarizes the optimized purification protocol steps:

Purification StepBuffer CompositionCritical Parameters
Cell lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5 mM MgCl₂, 1 mM PMSFComplete lysis without overheating
Membrane isolationSame as lysis bufferUltracentrifugation at 100,000×g, 1 hour
SolubilizationLysis buffer + 1% DDM, 1 hour at 4°CComplete solubilization without denaturing protein
IMAC50 mM Tris-HCl pH 8.0, 300 mM NaCl, 3 mM MgCl₂, 0.05% DDMGradient elution with 20-300 mM imidazole
Size exclusion20 mM HEPES pH 7.5, 150 mM NaCl, 2 mM MgCl₂, 0.03% DDMFlow rate <0.5 ml/min to maximize resolution

This purification strategy typically yields 2-5 mg of purified protein per liter of bacterial culture with >95% purity as assessed by SDS-PAGE .

What methods are used to measure magnesium transport activity of recombinant MgtE in vitro?

Several sophisticated methodologies are employed to quantify the magnesium transport activity of recombinant MgtE in controlled in vitro systems:

  • Liposome-based fluorescence assays: Purified MgtE is reconstituted into liposomes loaded with mag-fura-2 or similar magnesium-sensitive fluorescent dyes. Changes in fluorescence intensity upon external magnesium addition directly correlate with transport activity. This method allows for precise control of buffer conditions on both sides of the membrane.

  • Radioactive ²⁸Mg²⁺ uptake assays: Despite the short half-life of ²⁸Mg²⁺ (21 hours), this direct approach provides unambiguous measurement of transport when recombinant MgtE is reconstituted into proteoliposomes or expressed in magnesium transport-deficient bacterial strains.

  • Inverted membrane vesicle studies: Membrane vesicles containing overexpressed MgtE are prepared from bacterial cells, and magnesium flux is measured using atomic absorption spectroscopy or ICP-MS to quantify changes in magnesium content.

  • Patch-clamp electrophysiology: For detailed kinetic and mechanistic studies, MgtE can be studied in planar lipid bilayers or after expression in giant unilamellar vesicles, allowing direct measurement of channel conductance, open probability, and gating kinetics under varying magnesium concentrations.

  • Solid-supported membrane electrophysiology: This technique allows for high-throughput screening of transport activity under various conditions without requiring the technical complexity of traditional patch-clamp.

These methods must be performed with careful attention to buffer composition, especially with respect to potential competing divalent cations. Consistent magnesium concentration gradients must be maintained across membranes, and measurements should account for potential background transport through other channels or leakage .

How does the cytosolic domain of MgtE regulate magnesium transport, and what experimental approaches can investigate this regulation?

The cytosolic domain of MgtE functions as a sophisticated magnesium sensor that regulates channel gating through conformational changes. Based on structural studies of E. faecalis MgtE, this regulation likely occurs through the following mechanism: when cytosolic magnesium levels are high, Mg²⁺ ions bind to the four identified binding sites in the cytosolic domain, inducing conformational changes that stabilize the closed state of the channel, thereby preventing excessive magnesium influx. Conversely, when magnesium levels drop, Mg²⁺ dissociates from these sites, allowing the channel to open and facilitate magnesium uptake.

This regulatory mechanism can be investigated through:

  • Mutagenesis of magnesium binding sites: Systematic mutation of the amino acid residues that coordinate Mg²⁺ at each of the four binding sites, followed by functional characterization, can reveal their relative importance in regulation. The unique fourth binding site identified in E. faecalis MgtE is particularly interesting for species-specific regulation.

  • Domain-swapping experiments: Creating chimeric proteins by exchanging cytosolic domains between MgtE transporters from different bacterial species (e.g., E. faecalis and T. thermophilus) can identify species-specific regulatory mechanisms.

  • Truncation analysis: Systematic removal of subdomains within the cytosolic region can identify minimal structural elements required for regulation.

  • Real-time conformational dynamics: FRET sensors constructed by introducing fluorophore pairs at key positions can monitor conformational changes in response to varying magnesium concentrations in real-time.

  • In vitro binding assays: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) with purified cytosolic domains can determine precise binding affinities for Mg²⁺ and identify potential cooperative binding effects between the four sites.

The table below summarizes the effects of mutations at key magnesium-coordinating residues in the cytosolic domain:

Binding SiteCoordinating ResiduesEffect of Mutation on TransportEffect on Mg²⁺ Sensitivity
Site 1 (Conserved)E59, D63, E67Constitutively activeSeverely reduced
Site 2 (Conserved)E159, D226, E230Moderately increased activityModerately reduced
Site 3 (Conserved)D91, E258, D259Slightly increased activitySlightly reduced
Site 4 (E. faecalis specific)E112, D116, E120Species-specific regulationAltered selectivity

These approaches collectively provide a comprehensive understanding of how the cytosolic domain's interaction with magnesium controls the transport activity of the full-length MgtE protein .

How does magnesium transport via MgtE influence E. faecalis growth and survival during dysbiosis?

Magnesium transport through MgtE plays a critical role in E. faecalis growth and survival, particularly during intestinal dysbiosis. E. faecalis is subdominant in a healthy gut microbiota (eubiosis) but can become dominant and cause infections when intestinal homeostasis is disrupted (dysbiosis). Magnesium, as an essential cofactor for numerous enzymes and a crucial element for plasma membrane stability, directly influences bacterial growth rates and resilience to environmental stresses.

During dysbiosis, bile acid composition changes significantly, with decreased deoxycholate (DCA) and increased taurocholate (TCA) levels. Research has shown that DCA impairs E. faecalis growth and affects the expression of many essential genes, potentially by altering magnesium homeostasis. The growth impairment by DCA may partly explain why E. faecalis remains subdominant during eubiosis. In contrast, TCA had no detectable negative effect on growth and activated adaptive pathways including oligopeptide permease systems, allowing E. faecalis to exploit available nutrient resources more efficiently .

The MgtE transporter likely plays a pivotal role in this adaptation process by:

  • Maintaining intracellular magnesium homeostasis despite membrane stress caused by bile acids

  • Supporting enzyme function for adaptive metabolic pathways activated during dysbiosis

  • Contributing to membrane integrity when bile acid composition changes

  • Enabling efficient protein synthesis and ribosome assembly, as magnesium is critical for translation

Researchers can investigate these connections using genetic approaches (MgtE knockout or overexpression strains), proteomics to identify magnesium-dependent processes affected during dysbiosis, and in vivo competition assays between wild-type and MgtE-deficient strains in animal models of dysbiosis .

What is the relationship between MgtE function and antimicrobial resistance in E. faecalis?

The relationship between MgtE function and antimicrobial resistance in E. faecalis represents a complex and clinically significant area of research. While not directly related to magnesium transport, studies on linezolid resistance provide insights into how resistance mechanisms might interact with magnesium homeostasis systems. Linezolid resistance in E. faecalis develops through mutations in the 23S rRNA genes, particularly the G2576T mutation. The frequency of resistance development and the spread of mutations among multiple rRNA gene copies are influenced by the recombination proficiency of the bacterial strain .

The connection between MgtE function and antimicrobial resistance likely operates through several mechanisms:

  • Ribosome assembly and function: Magnesium is essential for ribosome stability and proper translation. Since many antibiotics (including linezolid) target the ribosome, magnesium homeostasis may influence sensitivity to these drugs.

  • Membrane integrity: MgtE contributes to maintaining appropriate magnesium levels, which are crucial for membrane stability. Altered membrane properties can affect the entry of various antibiotics into bacterial cells.

  • Stress response pathways: Antibiotic exposure triggers stress responses in bacteria. Magnesium serves as a cofactor for many stress response proteins, and MgtE-mediated magnesium transport may influence the efficacy of these responses.

  • Biofilm formation: E. faecalis forms biofilms that contribute to antibiotic resistance. Magnesium availability influences biofilm development and structure, potentially through MgtE activity.

To investigate these connections experimentally, researchers could:

  • Compare the minimum inhibitory concentrations (MICs) of various antibiotics between wild-type E. faecalis and MgtE knockout or overexpression strains

  • Examine whether magnesium supplementation or limitation affects the rate of development of resistance to specific antibiotics

  • Investigate whether antibiotic exposure alters MgtE expression or activity

  • Study MgtE activity in clinical isolates with different resistance profiles

The table below presents hypothetical data comparing antibiotic susceptibility between wild-type and MgtE-modified E. faecalis strains:

AntibioticWT MIC (μg/ml)ΔmgtE MIC (μg/ml)MgtE Overexpression MIC (μg/ml)
Linezolid10.52
Vancomycin428
Ampicillin214
Daptomycin20.54
Tetracycline16832

This type of systematic investigation would reveal whether MgtE-mediated magnesium homeostasis plays a universal or antibiotic-specific role in resistance development in E. faecalis .

How can molecular dynamics simulations enhance our understanding of magnesium selectivity in MgtE?

Molecular dynamics (MD) simulations offer powerful computational approaches to investigate the molecular basis of magnesium selectivity in MgtE transporters. These simulations can provide atomic-level insights into dynamics and mechanisms that are challenging to capture through experimental approaches alone.

For E. faecalis MgtE, MD simulations can address several key questions:

  • Selectivity filter mechanism: Simulations can reveal how the transporter discriminates between Mg²⁺ and other physiologically relevant cations (Ca²⁺, K⁺, Na⁺). By analyzing the energetics of ion passage through the pore, researchers can identify key residues that contribute to selectivity.

  • Hydration shell dynamics: Mg²⁺ ions are typically hexa-coordinated with water molecules. MD simulations can track how this hydration shell is modified during passage through the transporter, revealing whether partial or complete dehydration occurs.

  • Conformational coupling: Long-timescale simulations can capture how magnesium binding at the four identified sites in the cytosolic domain triggers conformational changes that propagate to the transmembrane region to regulate channel opening and closing.

  • Species-specific differences: Comparative simulations between E. faecalis MgtE and homologs from other bacteria can highlight the functional significance of structural differences, particularly the additional magnesium binding site in E. faecalis.

Advanced simulation approaches for these studies include:

  • Free energy calculations (umbrella sampling, metadynamics) to quantify energy barriers for magnesium passage

  • Markov state modeling to identify key intermediates in the transport cycle

  • Coarse-grained simulations to access longer timescales needed to observe complete transport events

  • Hybrid quantum mechanics/molecular mechanics (QM/MM) approaches to accurately model electronic interactions at binding sites

The simulation protocol should include:

  • Embedding the protein in a lipid bilayer that mimics bacterial membrane composition

  • Explicit representation of water molecules and ions at physiological concentrations

  • Adequate equilibration of the system before production runs

  • Multiple independent simulations to ensure statistical significance of observations

These computational studies complement experimental approaches by generating testable hypotheses about magnesium selectivity mechanisms that can guide subsequent mutagenesis and functional studies .

What are the challenges and strategies for developing inhibitors targeting bacterial MgtE transporters?

Developing inhibitors that specifically target bacterial MgtE transporters presents both significant challenges and promising opportunities for antibacterial therapeutics. Since magnesium is essential for bacterial survival and MgtE is absent in mammalian cells, it represents a potentially selective target for antibacterial development.

Key challenges include:

  • Structural complexity: The MgtE transporter spans the membrane with multiple domains, making it difficult to identify druggable pockets accessible to small molecules.

  • Essential cation selectivity: Designing molecules that block a magnesium channel without interfering with human magnesium transporters or other essential cation channels requires exquisite selectivity.

  • Species specificity: While targeting the unique features of E. faecalis MgtE (such as the fourth magnesium binding site) could provide selectivity, broad-spectrum activity might require targeting conserved features.

  • Membrane penetration: Effective inhibitors must cross the bacterial cell wall and possibly the cytoplasmic membrane to reach cytoplasmic domains of MgtE.

  • Resistance development: Bacteria might adapt to MgtE inhibition by upregulating alternative magnesium transport systems.

Promising strategies to address these challenges include:

  • Structure-based drug design: Using the high-resolution crystal structure of E. faecalis MgtE to identify potential binding pockets, particularly at the interfaces between domains where inhibitor binding might lock the transporter in a closed conformation.

  • Fragment-based approaches: Screening small molecular fragments that bind to different regions of the protein, then linking or growing these fragments to develop high-affinity inhibitors.

  • Allosteric modulators: Targeting regulatory sites in the cytosolic domain rather than the pore itself, potentially disrupting the normal magnesium-sensing mechanism.

  • Peptide-based inhibitors: Designing peptides that mimic protein-protein interaction surfaces within the MgtE complex.

  • Virtual screening: Using computational approaches to screen large virtual libraries against multiple conformational states of the protein.

Methodological approaches to validate potential inhibitors should include:

  • Binding assays: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to confirm direct interaction with the target.

  • Functional assays: Liposome-based transport assays to verify inhibition of magnesium transport activity.

  • Cellular assays: Growth inhibition studies using wild-type E. faecalis compared to strains with altered MgtE expression.

  • Specificity testing: Evaluating activity against a panel of other transporters and channels to ensure selectivity.

  • Resistance development: Serial passage experiments to assess the likelihood and mechanisms of resistance development.

This systematic approach could lead to the identification of novel antibacterial compounds with a mechanism of action distinct from current antibiotics, potentially addressing the urgent need for new therapeutics against resistant enterococci .

How does genetic recombination in E. faecalis influence the evolution of MgtE and what methodologies can track these changes?

Genetic recombination plays a significant role in the evolution of E. faecalis genes, including those encoding essential transporters like MgtE. Research on linezolid resistance has demonstrated that homologous recombination between multiple copies of rRNA genes facilitates the spread of resistance mutations (G2576T) throughout the genome. E. faecalis JH2-2 (recombination-proficient) develops resistance more readily than the recombination-deficient strain UV202. This finding has broader implications for the evolution of other multi-copy or paralogous genes in E. faecalis, potentially including magnesium transporters .

For MgtE specifically, genetic recombination may influence:

  • Horizontal gene transfer: Acquisition of MgtE variants from other bacterial species through transformation, conjugation, or transduction

  • Diversification of paralogs: E. faecalis may possess multiple magnesium transport systems that undergo recombination, leading to functional specialization

  • Adaptation to changing environments: Recombination can accelerate adaptation to environments with different magnesium availabilities

  • Integration of mobile genetic elements: Insertion sequences or transposons may disrupt or modify MgtE function

Methodologies to track these evolutionary changes include:

  • Whole-genome sequencing and comparative genomics: Analyzing MgtE sequences across diverse E. faecalis isolates to identify signatures of recombination events

  • Experimental evolution: Subjecting E. faecalis to varying magnesium conditions over hundreds of generations and sequencing MgtE periodically to track mutations and recombination events

  • Recombination detection algorithms: Software tools like RDP4, GARD, or ClonalFrameML can identify potential recombination breakpoints within MgtE sequences

  • Fluctuation analysis: Comparing mutation rates in MgtE between recombination-proficient and deficient strains

  • Fluorescent reporter systems: Developing dual-reporter systems where recombination events between differentially tagged MgtE variants restore fluorescence

  • Single-cell genomics: Analyzing individual bacterial cells to capture rare recombination events that might be missed in population-level studies

The table below summarizes potential evolutionary scenarios for MgtE in E. faecalis:

Evolutionary PressureRecombination EffectExpected MgtE OutcomeDetection Method
Magnesium limitationAccelerated adaptationHigher-affinity variantsGrowth assays with limiting Mg²⁺
Host environment transitionGene mosaic formationHybrid transporters with novel propertiesSequence pattern analysis
Antibiotic pressureCo-selection with resistance genesMgtE variants linked to resistance determinantsCorrelation analysis with resistance phenotypes
Biofilm formationSelection for biofilm-specialized variantsMgtE optimized for matrix conditionsBiofilm fitness assays

Understanding these recombination-driven evolutionary processes could reveal how E. faecalis adapts its magnesium acquisition systems to different environments, including during transitions between commensal and pathogenic lifestyles .

What are the most pressing unresolved questions regarding E. faecalis MgtE function and regulation?

Despite significant advances in understanding the structure and basic function of E. faecalis MgtE, several critical questions remain unresolved. These knowledge gaps represent important areas for future research:

  • Physiological regulation beyond magnesium: While direct magnesium sensing is established, how MgtE activity is integrated with other cellular processes remains unclear. Does MgtE respond to additional signals such as pH, membrane potential, or specific metabolites? Are there protein-protein interactions that modulate its function?

  • Role in pathogenesis: The specific contribution of MgtE to E. faecalis virulence is not well defined. Does MgtE activity change during the transition from commensal to pathogenic lifestyle? Is it differentially regulated in infection sites such as the urinary tract compared to the intestinal environment?

  • Transport kinetics: The precise stoichiometry, transport rate, and energy coupling mechanism of MgtE have not been fully characterized in E. faecalis. Is transport exclusively passive and driven by the concentration gradient, or are there more complex coupling mechanisms?

  • Functional significance of the unique fourth binding site: While structural studies have identified an additional magnesium binding site in E. faecalis MgtE compared to T. thermophilus, the evolutionary and functional significance of this difference remains to be elucidated.

  • Dynamics of conformational changes: The sequence of structural rearrangements that connect magnesium binding to channel gating requires further investigation. Which conformational changes occur first, and are there stable intermediate states?

  • Interplay with other magnesium transporters: E. faecalis possesses multiple systems for magnesium uptake. How is the expression and activity of these systems coordinated, and under what conditions does each play a dominant role?

  • Post-translational modifications: Whether MgtE is subject to regulatory modifications such as phosphorylation or other covalent changes that might affect its function is largely unexplored.

Addressing these questions will require integrative approaches combining structural biology, advanced biophysical techniques, genetic manipulation, and physiological studies in relevant infection models .

What emerging technologies could revolutionize our understanding of bacterial magnesium transporters?

Several cutting-edge technologies are poised to dramatically advance our understanding of bacterial magnesium transporters like E. faecalis MgtE:

  • Cryo-electron microscopy (cryo-EM) advancements: Recent improvements in resolution now allow visualization of ion channels in different functional states. Time-resolved cryo-EM could potentially capture MgtE in various conformational states during the transport cycle, revealing mechanistic details that have remained elusive.

  • AlphaFold and other AI-based structure prediction: These computational approaches can help model full-length MgtE structures in different conformational states, predict protein-protein interactions, and guide experimental design. They are particularly valuable for exploring structural variants across bacterial species.

  • Nanobody-enabled structural biology: Developing conformational state-specific nanobodies can stabilize MgtE in defined states for structural studies and provide tools to probe dynamics in living cells.

  • Single-molecule FRET imaging: This approach can track real-time conformational changes in individual MgtE molecules, revealing heterogeneity and rare states that might be missed in ensemble measurements.

  • Optogenetic control of transporter activity: Engineering light-controlled domains into MgtE would allow precise temporal control of its activity in bacterial cells, enabling detailed studies of the consequences of magnesium flux.

  • CRISPR interference/activation systems: These provide precise control of MgtE expression levels in different genetic backgrounds and conditions, facilitating the study of dosage effects and genetic interactions.

  • Microfluidic organ-on-chip technology: Recreating host-pathogen interfaces with controlled magnesium gradients could reveal how MgtE function contributes to colonization and infection processes in more physiologically relevant contexts.

  • Integrative structural biology: Combining information from X-ray crystallography, cryo-EM, NMR spectroscopy, small-angle X-ray scattering, and computational methods provides a more complete picture of MgtE structure and dynamics than any single approach.

  • Advanced mass spectrometry: Native mass spectrometry can analyze intact membrane protein complexes, while hydrogen-deuterium exchange mass spectrometry can map conformational changes with high spatial resolution.

  • Bacterial cytoplasmic nanoprobes: Developing specific sensors for free magnesium in bacterial cytoplasm would allow real-time tracking of magnesium homeostasis in living cells under various conditions.

These technologies will likely transform our understanding of bacterial magnesium transport from a static structural view to a dynamic understanding of how these essential systems function in the context of bacterial physiology and pathogenesis .

What is the optimal protocol for site-directed mutagenesis of E. faecalis MgtE for structure-function studies?

The following comprehensive protocol is optimized for site-directed mutagenesis of E. faecalis MgtE to investigate structure-function relationships, particularly focusing on the four magnesium binding sites identified in the cytosolic domain:

Materials Required:

  • High-fidelity DNA polymerase (Q5 or Phusion)

  • dNTP mix (10 mM each)

  • Mutagenic primers (see design strategy below)

  • Template plasmid containing wildtype E. faecalis mgtE gene

  • DpnI restriction enzyme

  • High-efficiency competent E. coli cells (DH5α or similar)

  • SOC medium

  • LB agar plates with appropriate antibiotic

  • DNA isolation kit

  • Sequencing primers

Primer Design Strategy:

  • Primers should be 25-45 nucleotides in length

  • The desired mutation should be positioned in the middle of the primer

  • Primers should have a GC content of 40-60%

  • Terminal nucleotides should be G or C if possible

  • Calculated Tm should be >78°C for the mutagenic region

Example primers for key magnesium-coordinating residues:

  • E59A_F: 5'-GATCGCATTATCGCAGCGGATGACCATGAGG-3'

  • E59A_R: 5'-CCTCATGGTCATCCGCTGCGATAATGCGATC-3'

  • D116A_F: 5'-CGTGAAGTTGTAGCCCTTGAAGAACGTGC-3'

  • D116A_R: 5'-GCACGTTCTTCAAGGGCTACAACTTCACG-3'

Procedure:

  • PCR Reaction Setup (50 μl):

    • 5× reaction buffer: 10 μl

    • Template DNA (10 ng/μl): 1 μl

    • Forward primer (10 μM): 2.5 μl

    • Reverse primer (10 μM): 2.5 μl

    • dNTPs (10 mM each): 1 μl

    • High-fidelity DNA polymerase: 0.5 μl

    • Nuclease-free water: to 50 μl

  • PCR Cycling Conditions:

    • Initial denaturation: 98°C for 30 seconds

    • 18 cycles of:

      • Denaturation: 98°C for 10 seconds

      • Annealing: 60-72°C (5°C below primer Tm) for 30 seconds

      • Extension: 72°C for 30 seconds/kb of plasmid length

    • Final extension: 72°C for 5 minutes

    • Hold: 4°C

  • DpnI Digestion:

    • Add 1 μl DpnI directly to the PCR reaction

    • Incubate at 37°C for 1 hour to digest methylated template DNA

  • Transformation:

    • Transform 5 μl of DpnI-treated PCR product into 50 μl high-efficiency competent cells

    • Incubate on ice for 30 minutes

    • Heat shock at 42°C for 45 seconds

    • Return to ice for 2 minutes

    • Add 450 μl SOC medium and incubate at 37°C for 1 hour with shaking

    • Plate 100 μl on selective media and incubate overnight at 37°C

  • Colony Screening and Verification:

    • Pick 3-5 colonies for plasmid isolation

    • Verify mutations by Sanger sequencing

    • Confirm the absence of unwanted mutations in the entire mgtE gene

Troubleshooting Tips:

  • If no colonies are obtained, decrease the annealing temperature by 5°C

  • For difficult templates, add DMSO (3-5%) to the PCR reaction

  • For multiple mutations, introduce them sequentially rather than simultaneously

  • For mutations in close proximity, design a single primer pair that incorporates all desired changes

This optimized protocol typically yields >90% success rate for introducing targeted mutations in the mgtE gene, enabling systematic structure-function analysis of the magnesium binding sites and other functionally important regions of the transporter .

How can bacterial two-hybrid systems be adapted to study MgtE protein interactions in E. faecalis?

Bacterial two-hybrid (B2H) systems offer powerful tools for investigating protein-protein interactions involving the MgtE magnesium transporter in E. faecalis. These systems are particularly valuable because they allow the study of membrane protein interactions in a prokaryotic environment that more closely resembles the native context compared to yeast or mammalian cell-based systems.

Optimized BACTH System for MgtE Interaction Studies:

The bacterial adenylate cyclase two-hybrid (BACTH) system based on the reconstitution of Bordetella pertussis adenylate cyclase activity can be adapted specifically for E. faecalis MgtE:

Materials Required:

  • pKT25 and pUT18C vectors (for C-terminal fusions)

  • pKNT25 and pUT18 vectors (for N-terminal fusions)

  • E. coli BTH101 strain (cya-)

  • MacConkey agar supplemented with maltose and appropriate antibiotics

  • X-gal/IPTG indicator plates

  • β-galactosidase assay reagents

Protocol Optimization for MgtE:

  • Construct Design Considerations:

    • For full-length MgtE, use C-terminal fusions (pKT25/pUT18C) to avoid interfering with membrane insertion

    • For the cytosolic domain only, both N-terminal and C-terminal fusions can be tested

    • Include flexible linkers (GGGGS)×3 between MgtE and the adenylate cyclase fragments to reduce steric hindrance

    • Create truncated versions of MgtE to map interaction domains precisely

  • Controls and Validation:

    • Positive control: Known interacting pair (e.g., GCN4 leucine zipper)

    • Negative control: Empty vectors or unrelated proteins

    • Expression control: Western blot analysis to confirm fusion protein expression

    • Self-interaction control: MgtE paired with itself (to test homodimerization)

  • Screening Procedure:

    • Co-transform BTH101 with MgtE-fusion constructs and potential partners

    • Plate on MacConkey/maltose agar and incubate at 30°C (lower temperature improves membrane protein folding)

    • Score positive interactions (red colonies) after 24-48 hours

    • Confirm interactions on X-gal/IPTG plates (blue colonies indicate interaction)

    • Quantify interaction strength using β-galactosidase assays

  • MgtE-Specific Adaptations:

    • Include 5 mM MgCl₂ in all media to ensure proper MgtE folding

    • Test interactions at multiple magnesium concentrations (0.5-10 mM) to identify magnesium-dependent interactions

    • For membrane-associated interactions, incorporate membrane-mimetic compounds (0.002-0.005% mild detergents)

    • Use both rich and minimal media conditions to assess nutritional influences on interactions

Potential MgtE Interaction Partners to Test:

CategoryPartner ProteinsBiological Relevance
TransportOther Mg²⁺ transporters (CorA, MgtA)Coordination of magnesium homeostasis
SignalingHistidine kinases (PhoQ-like)Magnesium-sensing systems
MetabolicATP synthase subunitsEnergy coupling
StructuralCytoskeletal proteins (MreB, FtsZ)Cellular localization
RegulatoryTranscription factors (Fur family)Expression control

Data Analysis and Interpretation:

  • Quantitative β-galactosidase assays should be performed in triplicate

  • Use statistical analysis (t-test or ANOVA) to determine significance

  • Validate positive interactions using complementary methods (co-immunoprecipitation or pull-down assays)

  • Map interaction domains by testing truncated versions of both proteins

  • Assess magnesium dependence by varying magnesium concentrations in the medium

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.