Recombinant Enterococcus faecalis Sensor protein vanSB (vanSB)

Shipped with Ice Packs
In Stock

Description

Introduction

Enterococcus faecalis is a bacterium known for its ability to develop resistance to vancomycin, a critical antibiotic . Vancomycin-resistant Enterococci (VRE) pose a significant threat, and type-B resistance is particularly concerning . The van cluster, which facilitates vancomycin resistance, is regulated by the VanSR two-component system . VanS, a sensor histidine kinase, plays a crucial role in detecting vancomycin and initiating a response . Specifically, the recombinant Enterococcus faecalis sensor protein VanSB (VanSB) is central to this regulatory mechanism .

Function and Mechanism

VanSB is essential for detecting vancomycin in the cellular environment and triggering the appropriate resistance response . As an integral membrane protein, VanSB contains a kinase domain and a sensor region that work in tandem to initiate the resistance mechanism when vancomycin is present .

The process unfolds as follows :

  1. Vancomycin Detection: VanSB detects vancomycin in the cell.

  2. Dimerization and Autophosphorylation: Upon detection, VanSB dimerizes and undergoes autophosphorylation in its cytoplasmic kinase domain.

  3. Phosphotransfer: The phosphate group is then transferred to VanR, a cytosolic response regulator.

  4. Gene Expression: Phosphorylated VanR binds upstream of the van transcription elements, inducing the expression of resistance proteins.

VanS activates VanR through phosphorylation, which involves the transfer of a phosphate group from ATP to a protein L-histidine residue, forming ADP and protein N-phospho-L-histidine .

Interaction with Vancomycin

The mechanism by which VanSB detects vancomycin has been a topic of debate . Research indicates that VanSB directly binds to vancomycin, triggering its activation . Studies have pinpointed the extracellular region of VanS as the site of this interaction, revealing a predominantly α-helical conformation .

Key findings include:

  • Vancomycin directly stimulates VanSB activity .

  • The periplasmic domain of VanSB is the binding site for vancomycin .

  • Vancomycin increases VanSB's autophosphorylation activity and slightly reduces its phosphatase activity .

Experimental Evidence

Reconstitution of VanSB into nanodiscs maintains a native-like membrane environment, allowing for detailed study of its enzymatic activities . The autokinase activity of type-B VanS is markedly stimulated by vancomycin, which is mediated by a direct physical interaction between the antibiotic and the type-B VanS protein .

Table 1: Binding Affinities of Vancomycin to VanSB Sensor Domain

ConstructDissociation Constant (KD)
Single-Copy Sensor Domain20.3 μM
Tandem Sensor Domain10.7 μM

These values, obtained through fluorescence anisotropy, indicate a direct and specific binding interaction between vancomycin and the periplasmic sensor domain of VanSB .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vanSB; EF_2298; Sensor protein VanSB; Vancomycin B-type resistance protein VanSB; Vancomycin histidine protein kinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Enterococcus faecalis (strain ATCC 700802 / V583)
Target Names
vanSB
Target Protein Sequence
MERKGIFIKVFSYTIIVLLLLVGVTATLFAQQFVSYFRAMEAQQTVKSYQPLVELIQNSD RLDMQEVAGLFHYNNQSFEFYIEDKEGSVLYATPNADTSNSVRPDFLYVVHRDDNISIVA QSKAGVGLLYQGLTIRGIVMIAIMVVFSLLCAYIFARQMTTPIKALADSANKMANLKEVP PPLERKDELGALAHDMHSMYIRLKETIARLEDEIAREHELEETQRYFFAAASHELKTPIA AVSVLLEGMLENIGDYKDHSKYLRECIKMMDRQGKTISEILELVSLNDGRIVPIAEPLDI GRTVAELLPDFQTLAEANNQRFVTDIPAGQIVLSDPKLIQKALSNVILNAVQNTPQGGEV RIWSEPGAEKYRLSVLNMGVHIDDTALSKLFIPFYRIDQARSRKSGRSGLGLAIVQKTLD AMSLQYALENTSDGVLFWLDLPPTSTL
Uniprot No.

Target Background

Function
Recombinant Enterococcus faecalis Sensor protein vanSB (vanSB) is a component of the two-component regulatory system VanS/VanR. It activates transcription of vanH, vanA, and vanX genes in response to vancomycin, leading to vancomycin resistance. VanS activates VanR through phosphorylation.
Database Links

KEGG: efa:EF2298

STRING: 226185.EF2298

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of VanSB in vancomycin resistance?

VanSB functions as a histidine kinase within the VanRB-VanSB two-component regulatory system that controls vancomycin resistance gene expression in Enterococcus faecalis. In the absence of vancomycin, VanSB acts as a phosphatase, removing phosphate groups from VanRB, thereby repressing resistance gene expression. When vancomycin is present, VanSB switches to kinase activity, phosphorylating VanRB and activating transcription of vancomycin resistance genes .

This activation leads to the synthesis of modified peptidoglycan precursors terminating in D-alanyl-D-lactate (D-Ala-D-Lac) instead of D-alanyl-D-alanine (D-Ala-D-Ala), resulting in significantly reduced vancomycin binding affinity and consequent resistance .

How does the structure of VanSB differ from VanSA in sensing mechanisms?

VanSB and VanSA represent distinct vancomycin-sensing mechanisms despite their functional similarities:

FeatureVanSB (VanB-type)VanSA (VanA-type)
Inducer specificityDirect vancomycin bindingUnknown factors associated with vancomycin-induced stress
Teicoplanin responseNot induced by teicoplaninInduced by teicoplanin
Membrane topologyTwo hydrophobic domains similar to EnvZSimilar membrane topology
Signaling mechanismSwitches between phosphatase/kinase activitiesSwitches between phosphatase/kinase activities

VanSB contains two stretches of hydrophobic amino acids that create a membrane topology similar to EnvZ sensor kinases. The N-terminal domain functions as the sensory component, specifically binding vancomycin, while VanSA responds to unknown factors associated with vancomycin-induced stress rather than direct antibiotic binding .

What expression systems are most effective for recombinant VanSB production?

For laboratory-scale expression of functional recombinant VanSB, the following methodological approaches have proven effective:

  • E. coli-based expression: The full-length VanSB protein (447 amino acids) can be successfully expressed in E. coli with N-terminal His-tag fusion for purification . This system offers high yields and straightforward purification protocols.

  • Vector selection: Expression vectors such as pAT400 allow constitutive expression of vanSB, useful for regulatory studies when co-expressed with reporter constructs .

  • Protein handling: After expression, storing the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0 helps maintain stability. For long-term storage, adding glycerol to 50% final concentration and storing at -20°C/-80°C in aliquots prevents activity loss from freeze-thaw cycles .

The methodology requires careful optimization of induction conditions and extraction procedures to maintain the membrane-associated protein in its native conformation.

How can researchers experimentally validate cross-talk between VanSB and other two-component systems?

Investigating cross-talk between VanSB and other two-component systems requires multiple complementary approaches:

  • RNA-Seq analysis: Differential gene expression analysis after antibiotic treatment can identify genes regulated by multiple TCS. For example, comparing transcriptional responses in VanB-type V583 and VanA-type HIP11704 strains after ceftriaxone and vancomycin treatments has revealed cross-talk between VanS and CroR systems .

  • Direct Coupling Analysis (DCA): This computational approach can identify potential evolutionary coupling between exogenous and endogenous TCS components, predicting protein-protein interactions that may indicate cross-talk .

  • Phosphotransfer profiling: In vitro assays using purified proteins to detect phosphotransfer between non-cognate histidine kinases and response regulators.

  • Mutational analysis: Creating targeted mutations in specificity residues of VanSB and measuring phosphorylation of non-cognate response regulators.

  • Antibiotic susceptibility testing: The synergistic effect of combination treatments (e.g., vancomycin with ceftriaxone) can provide phenotypic evidence of cross-talk between resistance pathways. Standard protocols involve determining MICs through broth microdilution with antibiotic concentrations ranging from 2-2048 μg/mL .

What are the mechanisms underlying the differential induction of VanB-type resistance by vancomycin versus teicoplanin?

The differential induction of VanB-type resistance by vancomycin but not teicoplanin involves specific molecular mechanisms:

  • Ligand binding specificity: The N-terminal sensory domain of VanSB appears to have evolved specificity for vancomycin rather than teicoplanin, despite their structural similarities. This binding initiates the phosphorylation cascade .

  • Experimental evidence: When VanB-type strains are pre-induced with vancomycin, they become resistant to both vancomycin and teicoplanin, indicating that the resistance mechanism itself works against both glycopeptides but is only triggered by vancomycin .

  • Mutational evidence: The isolation of mutants with constitutive resistance to both vancomycin and teicoplanin suggests that alterations in the regulatory system rather than the resistance mechanism itself determine differential antibiotic responses .

  • Methodological approach for investigation: Researchers can investigate this phenomenon using transcriptional fusions with reporter genes (e.g., cat) under control of resistance gene promoters, measuring their activation with various glycopeptide antibiotics. CAT activity assays of S100 cell extracts can quantify gene expression levels in response to different inducers .

What methodologies can researchers employ to study VanSB phosphorylation states and their impact on signaling?

Investigating VanSB phosphorylation dynamics requires specialized techniques:

  • Phos-tag SDS-PAGE: This modified gel electrophoresis method can separate phosphorylated and non-phosphorylated VanSB forms, allowing quantification of phosphorylation levels under various conditions.

  • Mass spectrometry: Phosphoproteomics approaches can identify specific phosphorylation sites and quantify their occupancy, particularly useful when combined with stable isotope labeling.

  • Phosphotransfer kinetics: In vitro assays using purified VanSB and radiolabeled ATP (γ-³²P) can measure autophosphorylation rates and subsequent phosphotransfer to VanRB. Reaction conditions typically include:

    • Buffer: 50 mM Tris-HCl (pH 7.5), 50 mM KCl, 5 mM MgCl₂

    • Temperature: 25°C

    • ATP concentration: 50 μM with trace γ-³²P-ATP

    • Protein concentration: 5-10 μM VanSB

  • Site-directed mutagenesis: Modifying the conserved histidine residue in VanSB's catalytic domain abolishes kinase activity while potentially maintaining phosphatase function, allowing separation of these activities.

  • Phosphomimetic mutations: Substituting aspartate for the phospho-accepting histidine can mimic constitutive phosphorylation for functional studies.

How can researchers investigate the role of VanSB in biofilm formation and virulence?

The potential role of VanSB in biofilm formation and virulence requires multifaceted investigation approaches:

  • Static biofilm assays: Comparing biofilm formation between wild-type and vanSB mutant strains using crystal violet staining in 96-well plates. This can be quantified spectrophotometrically at 595 nm after solubilization with ethanol-acetone.

  • Flow cell systems: For more dynamic biofilm studies, flow cells coupled with confocal microscopy using fluorescently labeled strains can visualize biofilm architecture differences.

  • Virulome analysis: Whole-genome sequence analysis can identify virulence gene co-occurrence with vanB clusters. Key virulence factors to examine include:

    • Adhesion factors: ace, ebpA, ebpB, ebpC, ecbA

    • Exoenzymes: gelE, sprE

    • Biofilm formation: bopD, fsrA, fsrB, fsrC

    • Immune modulation: cpsA-K

    • Exotoxins: cylL-l, cylL-s

  • Real-time PCR: Quantifying expression of virulence genes in response to vanSB activation or deletion.

  • Animal infection models: Comparing wild-type and vanSB mutant strains in standardized infection models (e.g., Galleria mellonella or mouse peritonitis models) to assess contribution to virulence.

What molecular approaches can identify VanSB interaction partners beyond VanRB?

Identifying novel VanSB interaction partners requires these methodological approaches:

  • Bacterial two-hybrid (B2H) screening: By fusing VanSB to one domain of adenylate cyclase and a genomic library to another domain, interactions restore cyclase activity and can be detected through reporter gene expression.

  • Co-immunoprecipitation: Using anti-VanSB antibodies or epitope tags to pull down protein complexes from cell lysates, followed by mass spectrometry identification of interacting partners.

  • Crosslinking coupled with mass spectrometry (XL-MS): Chemical crosslinkers can stabilize transient interactions before protein complex isolation and characterization.

  • Surface plasmon resonance (SPR): For validation of specific interactions, purified VanSB can be immobilized on a sensor chip and potential partners flowed over to measure binding kinetics.

  • Computational prediction: Direct coupling analysis and protein-protein interaction prediction algorithms can identify potential interacting partners based on evolutionary co-variation patterns, particularly useful for finding cross-talk with other two-component systems .

How can genetic manipulation systems be optimized for functional VanSB studies in Enterococcus faecalis?

Effective genetic manipulation of vanSB in Enterococcus faecalis requires specialized approaches:

  • CRISPR-Cas9 system optimization: Recent adaptations for Enterococcus include:

    • Temperature-sensitive plasmids for transient Cas9 expression

    • Appropriate promoters for sgRNA expression

    • Optimization of homology arm length (500-1000 bp)

    • Electroporation conditions: 25 μF, 200 Ω, 2.5 kV/cm

  • Allelic replacement vectors: Using suicide vectors containing counterselectable markers (e.g., pheS*) for scarless deletion or modification of vanSB.

  • Transcriptional fusions: Reporter constructs like pAT78 containing promoterless cat (chloramphenicol acetyltransferase) genes allow quantification of vanSB-regulated promoter activity under various conditions .

  • Inducible expression systems: Nisin-inducible or tetracycline-inducible promoters can control vanSB expression levels for complementation studies.

  • Heterologous expression: For biochemical studies, expressing vanSB in E. coli with appropriate tags (His, MBP, GST) facilitates protein purification while maintaining functionality .

What analytical methods are most effective for studying VanSB-mediated signaling dynamics in real-time?

Studying real-time dynamics of VanSB signaling requires sophisticated approaches:

  • FRET-based biosensors: Constructing fusion proteins with fluorescent protein pairs allowing measurement of protein interactions or conformational changes upon vancomycin binding.

  • Microscale thermophoresis (MST): For measuring binding kinetics of vancomycin to purified VanSB, detecting subtle changes in thermophoretic mobility upon ligand binding.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping structural changes in VanSB upon vancomycin binding by measuring deuterium incorporation rates.

  • Luciferase reporter systems: Real-time measurement of transcriptional responses by placing luciferase under control of VanSB-regulated promoters.

  • Single-cell microscopy: Using fluorescent reporters to visualize activation of VanSB signaling at the single-cell level, revealing population heterogeneity.

  • Phosphoproteomics time course: Quantitative mass spectrometry to measure phosphorylation states across the proteome at different time points after vancomycin exposure.

How can researchers differentiate between the direct effects of VanSB activation and secondary regulatory cascades?

Distinguishing primary from secondary effects in the VanSB regulatory cascade requires these methodological approaches:

  • Temporal transcriptomics: RNA-Seq analysis at multiple time points (e.g., 15, 30, 45, and 60 minutes) after vancomycin exposure can separate immediate VanSB-dependent responses from secondary effects .

  • Phosphorylation-locked VanSB variants: Creating constitutively active or inactive VanSB mutants through point mutations in the phosphorylation site.

  • ChIP-Seq of VanRB: Chromatin immunoprecipitation followed by sequencing to identify all genomic regions directly bound by phosphorylated VanRB, distinguishing direct targets.

  • Combinatorial mutant analysis: Creating strains with mutations in VanSB and potential downstream regulators to identify epistatic relationships.

  • Proteomics with quantitative diGly capture: Monitoring ubiquitination changes following VanSB activation to identify post-translational regulation cascades.

  • Metabolomics analysis: Identifying metabolic changes that occur as downstream consequences of VanSB activation rather than direct regulatory effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.