Recombinant Enterococcus faecalis UPF0316 protein EF_1609 (EF_1609) is a protein derived from the bacterium Enterococcus faecalis. This protein is part of the UPF0316 family, which is characterized by its conserved sequence across different species but lacks a well-defined function. The recombinant version of this protein is produced in Escherichia coli and is fused with a His-tag for easier purification and identification.
The recombinant EF_1609 protein is a full-length protein consisting of 183 amino acids. It is expressed in E. coli and purified to a high degree, with a purity of greater than 90% as determined by SDS-PAGE. The protein is provided in a lyophilized form and is recommended to be stored at -20°C or -80°C to maintain its integrity. Reconstitution is typically done in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the option to add glycerol for long-term storage.
| Characteristics | Description |
|---|---|
| Species | Enterococcus faecalis |
| Source | E. coli |
| Tag | His-tag |
| Protein Length | Full Length (1-183 amino acids) |
| Form | Lyophilized powder |
| Purity | >90% by SDS-PAGE |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
The amino acid sequence of the EF_1609 protein is crucial for understanding its structure and potential functions. The sequence is as follows:
MVVDLKMLAMIFIINFAYITLNTIRFMLTMKGYRVIAPLVSMAEITIYVLGLSMVLNRLD NPLNLLVYALGYAVGISVGIKIEDYLALGYIMVSVILPSTTEQFHLPETLREHGYGVTQS VAYGREGERMVLEILSPRKNERTLYKLINQLEPRAFIISYEPKFISGGFWTKKVRKRNDA ISH.
This sequence provides insights into the protein's structure and potential interactions with other molecules.
KEGG: efa:EF1609
STRING: 226185.EF1609
The Recombinant Enterococcus faecalis UPF0316 protein EF_1609 belongs to the UPF0316 protein family, which consists of conserved proteins with unknown functions. Structural analysis typically involves expressing the protein in a suitable expression system, purifying it using chromatographic techniques, and then characterizing it using methods such as X-ray crystallography, nuclear magnetic resonance (NMR), or cryo-electron microscopy. When working with recombinant proteins, researchers often utilize bacterial expression systems similar to those described for other E. faecalis proteins, where the plasmid containing the target gene is electrotransformed into the host strain . The purified protein can then be analyzed for secondary structure elements using circular dichroism spectroscopy, which provides information about alpha-helices, beta-sheets, and random coils.
Expression of Recombinant Enterococcus faecalis UPF0316 protein EF_1609 typically follows a methodological approach similar to other E. faecalis proteins. The general procedure involves:
Gene cloning: Amplify the EF_1609 gene without start codon ATG and terminator codon TAA from E. faecalis genomic DNA using PCR.
Vector construction: Insert the amplified gene into an expression vector (such as pTX8048) containing appropriate regulatory elements.
Transformation: Electrotransform the recombinant plasmid into a suitable E. faecalis strain (such as MDXEF-1 or another laboratory strain) .
Protein expression: Induce protein expression under optimal conditions, which typically include specific temperature, media composition, and induction time.
Verification: Confirm protein expression using Western blot analysis with appropriate antibodies .
This methodology can be adapted based on specific research requirements, such as anchoring the protein to the cell wall using cell wall anchor (CWA) sequences or expressing it as a fusion protein with specific tags for downstream applications .
Detection and quantification of Recombinant EF_1609 protein typically employ multiple complementary techniques:
Western blot analysis: This is the gold standard for specific protein detection. The procedure involves protein extraction, SDS-PAGE separation, transfer to a membrane, and immunodetection using antibodies specific to EF_1609 or fusion tags (if applicable) .
ELISA (Enzyme-Linked Immunosorbent Assay): For quantitative analysis of the protein in various samples.
Flow cytometry: Particularly useful for detecting surface-displayed proteins when EF_1609 is expressed as a cell wall-anchored protein .
Mass spectrometry: For precise identification and characterization of the protein and potential post-translational modifications.
Fluorescence microscopy: When the protein is fused with fluorescent tags, enabling visualization of its cellular localization.
The choice of method depends on research objectives, available resources, and whether the protein is expressed intracellularly or anchored to the cell wall using CWA sequences .
Optimal growth conditions for E. faecalis strains expressing recombinant EF_1609 typically require careful optimization of several parameters:
Culture medium: Brain Heart Infusion (BHI) broth supplemented with appropriate selective antibiotics based on the resistance markers in the expression vector.
Temperature: Standard growth at 37°C, but expression may be optimized at lower temperatures (28-30°C) to enhance proper protein folding.
Aeration: E. faecalis is facultatively anaerobic, so cultures can be grown with or without aeration depending on specific strain requirements.
pH: Maintain pH between 6.8-7.2 for optimal growth.
Induction conditions: If using an inducible promoter system, determine the optimal inducer concentration and induction time.
Cell density: Monitor growth by measuring optical density (OD600) and induce expression at the appropriate cell density, typically mid-log phase.
Harvest time: Determine the optimal time post-induction for harvesting cells to maximize protein yield while maintaining protein integrity.
Similar approaches have been documented for other recombinant E. faecalis expression systems, where bacteria are typically cultured to a concentration of 5 × 10^9 CFU for experimental applications .
Optimizing the immunogenicity of Recombinant EF_1609 for vaccine development involves several strategic approaches based on established immunological principles:
Fusion with immunostimulatory molecules: Consider fusing EF_1609 with dendritic cell-targeting peptides (DCpep) to enhance antigen presentation and immune response. Research has demonstrated that DCpep fusion proteins delivered by probiotic bacteria significantly enhance antigen-induced systemic immune responses .
Surface display strategy: Anchor the EF_1609 protein to the bacterial cell surface using cell wall anchor (CWA) sequences. This approach has shown enhanced immunogenicity compared to secreted proteins .
Adjuvant selection: Test various adjuvants to determine which best complements EF_1609 immunogenicity.
Delivery system optimization: Consider multiple immunization routes (oral, intranasal, parenteral) and regimens. In previous studies with recombinant E. faecalis vaccines, protocols involving three immunizations at 2-week intervals have proven effective .
Immune response assessment: Evaluate both humoral and cellular immune responses through:
The immunization schedule should be carefully designed, with preliminary data suggesting a regimen similar to that shown in Table 1.
| Group | Primary Immunization (Days 5-7) | Secondary Immunization (Days 21-23) | Third Immunization (Days 37-39) | Challenge/Assessment (Day 54) |
|---|---|---|---|---|
| 1 | Recombinant E. faecalis expressing EF_1609 (5 × 10^9 CFU) | Recombinant E. faecalis expressing EF_1609 (5 × 10^9 CFU) | Recombinant E. faecalis expressing EF_1609 (5 × 10^9 CFU) | Immune response assessment |
| 2 | Recombinant E. faecalis expressing DCpep-EF_1609 (5 × 10^9 CFU) | Recombinant E. faecalis expressing DCpep-EF_1609 (5 × 10^9 CFU) | Recombinant E. faecalis expressing DCpep-EF_1609 (5 × 10^9 CFU) | Immune response assessment |
| 3 | E. faecalis with empty vector (5 × 10^9 CFU) | E. faecalis with empty vector (5 × 10^9 CFU) | E. faecalis with empty vector (5 × 10^9 CFU) | Immune response assessment |
| 4 | PBS (pH 7.2) | PBS (pH 7.2) | PBS (pH 7.2) | Immune response assessment |
The cellular and molecular mechanisms underlying immune responses to Recombinant EF_1609 involve complex interactions between the innate and adaptive immune systems:
Antigen processing and presentation: When EF_1609 is expressed on the surface of E. faecalis or as a fusion protein with DCpep, it can directly interact with dendritic cells (DCs) in the intestinal lamina propria. DCpep has been shown to specifically bind to receptors on DC surfaces, enhancing antigen uptake and presentation .
T-cell activation: Following antigen presentation, DCs migrate to lymphoid tissues where they activate:
CD4+ T helper cells, which orchestrate downstream immune responses
CD8α+ cytotoxic T cells, which provide cell-mediated immunity
Flow cytometric analysis of peripheral blood lymphocytes can be performed using fluorescein isothiocyanate-conjugated anti-CD4+ and phycoerythrin-conjugated anti-CD8α+ antibodies to quantify these populations .
Cytokine production: Activated T cells secrete various cytokines, particularly:
IL-2: Promotes T-cell proliferation
IFN-γ: Enhances macrophage activation and Th1 responses
These cytokines can be measured at the mRNA level using RT-PCR or at the protein level using ELISA .
Antibody production: B cells produce antigen-specific antibodies:
Serum IgG: Provides systemic immunity
Secretory IgA: Critical for mucosal immunity, particularly in the intestinal tract
These antibodies can be quantified using ELISA from serum samples and mucosal lavage respectively .
Memory response: Establishment of immunological memory provides long-term protection through memory B and T cells.
Understanding these mechanisms requires comprehensive immunological assessment protocols that measure both cellular and humoral immune components.
Vector design significantly impacts both expression efficiency and immunogenicity of Recombinant EF_1609 through multiple factors:
Promoter selection: The strength and regulation of the promoter determine expression levels. Constitutive promoters provide continuous expression, while inducible promoters offer controlled expression.
Signal peptide optimization: The signal peptide sequence (SP) directs protein secretion or anchoring. Optimizing this element can significantly improve protein translocation efficiency .
Cell wall anchoring domains: Incorporating cell wall anchor (CWA) sequences enables surface display of EF_1609, which generally enhances immunogenicity compared to secreted forms. The CWA from Gram-positive bacteria typically contains LPXTG motifs recognized by sortase enzymes that covalently attach the protein to peptidoglycan .
Fusion partners: Strategic fusion with immunostimulatory molecules like DCpep can enhance targeted delivery to immune cells. Research has demonstrated that DCpep fusion proteins specifically bind to receptors on dendritic cell surfaces, increasing antigen uptake and presentation efficiency .
Codon optimization: Adapting the coding sequence to the codon usage bias of E. faecalis can significantly improve translation efficiency and protein yield.
Vector backbone elements: Selection of appropriate origin of replication, antibiotic resistance markers, and transcriptional terminators impacts plasmid stability and expression levels.
Removal of unnecessary elements: Eliminating start codons (ATG) and terminator codons (TAA) from the target gene when designing fusion constructs ensures proper expression of the complete fusion protein .
Experimental data have shown that recombinant E. faecalis expressing DCpep-fusion proteins elicits significantly stronger immune responses compared to those expressing the target protein alone, with higher levels of serum IgG, secretory IgA, CD4+/CD8+ T-cell populations, and cytokine expression .
Evaluating the stability and functionality of purified Recombinant EF_1609 requires comprehensive analysis of several critical parameters:
Protein integrity assessment:
SDS-PAGE for molecular weight confirmation and purity evaluation
Western blot for identity verification using specific antibodies
Mass spectrometry for precise molecular weight determination and detection of post-translational modifications
N-terminal sequencing to confirm correct processing of the signal peptide
Structural characterization:
Circular dichroism (CD) spectroscopy to analyze secondary structure
Fluorescence spectroscopy to evaluate tertiary structure
Dynamic light scattering to assess homogeneity and aggregation state
Thermal shift assays to determine thermal stability (Tm)
Functional analysis:
Binding assays to evaluate interaction with target receptors (particularly important for DCpep fusion proteins)
Immunological assays to assess antigenicity and immunogenicity
Cell-based assays to determine biological activity
Stability studies:
Accelerated stability testing under various conditions (temperature, pH, ionic strength)
Long-term stability assessment during storage
Freeze-thaw stability to determine appropriate handling procedures
Aggregation propensity using techniques like size exclusion chromatography
Quality control parameters:
Endotoxin testing using Limulus Amebocyte Lysate (LAL) assay
Host cell protein (HCP) quantification
Residual DNA quantification
Sterility testing
For recombinant proteins intended for immunological studies, functional characterization should include verification of proper display on bacterial surfaces when using CWA anchoring systems, as well as confirmation of specific binding to target immune cells when incorporating targeting peptides like DCpep .
Reconciling and analyzing contradictory data regarding the immunological effects of Recombinant EF_1609 requires a systematic approach:
Methodological standardization analysis:
Compare experimental protocols in detail, including bacterial strain selection, vector design, culture conditions, and purification methods
Standardize immunization protocols, including dose, route, adjuvants, and schedule
Ensure consistent methods for immune response assessment
Strain and expression system variation assessment:
Host factors consideration:
Analyze genetic background of experimental animals
Compare age, sex, and microbiome composition of test subjects
Consider pre-existing immunity to E. faecalis
Statistical rigor evaluation:
Assess sample sizes and power calculations
Review statistical methods and significance thresholds
Consider biological vs. statistical significance
Integrated data analysis:
Perform meta-analysis when sufficient comparable studies exist
Use systems biology approaches to integrate transcriptomic, proteomic, and immunological data
Develop mathematical models to predict immune responses based on experimental variables
Validation experiments design:
Mechanistic investigations:
Analyze specific immune cell populations using flow cytometry
Measure both Th1 and Th2 cytokine profiles
Evaluate mucosal vs. systemic immune responses separately
Research has demonstrated that multiple factors, including fusion with DCpep, can significantly alter the immunological profile of recombinant proteins expressed in E. faecalis, resulting in enhanced CD4+ and CD8+ T-cell responses and elevated cytokine production .
Designing experiments to evaluate the effect of Recombinant EF_1609 on host immune response requires careful consideration of multiple factors:
Experimental groups design:
Immunization protocol:
Route: Oral administration is typically used for intestinal immune response studies with E. faecalis
Dosage: Standardized bacterial concentrations (5 × 10^9 CFU per dose)
Schedule: Primary immunization followed by boosters at 2-week intervals
Duration: Typically three immunization cycles over 4-6 weeks
Immune response assessment timeline:
Pre-immunization baseline measurements
Post-primary immunization (day 14)
Post-secondary immunization (day 35)
Post-tertiary immunization (day 49)
Long-term immunity assessment (optional)
Comprehensive immune profiling:
Humoral immunity: Serum IgG and mucosal secretory IgA levels via ELISA
Cellular immunity: Flow cytometric analysis of CD4+ and CD8α+ T-cell populations
Cytokine profiling: RT-PCR for IL-2, IFN-γ, and other relevant cytokines
Functional assays: Lymphocyte proliferation in response to antigen re-stimulation
Statistical analysis plan:
Sample size calculation based on expected effect size
Appropriate statistical tests for each data type
Multiple comparison corrections
Reporting of effect sizes alongside p-values
This experimental design allows for comprehensive evaluation of both the magnitude and quality of immune responses induced by Recombinant EF_1609, while controlling for vector-specific effects and natural immune fluctuations.
Designing comparative experiments for different expression systems of Recombinant EF_1609 requires a systematic approach:
This approach enables objective comparison of different expression systems while accounting for system-specific requirements, ultimately facilitating selection of the optimal system for EF_1609 production based on research or application needs.
Investigating the structure-function relationship of Recombinant EF_1609 requires an integrated approach combining structural biology techniques with functional assays:
When studying recombinant proteins expressed in E. faecalis, considering the impact of cell wall anchoring domains and fusion partners (like DCpep) on structure and function is particularly important, as these elements can significantly influence protein conformation and accessibility .
Recombinant EF_1609 can be utilized as a versatile research tool in immunological studies through several applications:
Antigen delivery system development:
Adjuvant research platform:
For testing novel adjuvant combinations
In studying mucosal immune responses
As a carrier for heterologous epitopes
Dendritic cell targeting research:
Immune response mechanism studies:
Vaccine platform development:
As a model antigen in novel vaccine delivery systems
For testing prime-boost strategies
In developing mucosal vaccination approaches
Methodological applications:
Experimental control applications:
As a standardized positive control in immunological assays
For validating new immunological techniques
In training exercises for technical personnel
When used as a research tool, it's important to implement comprehensive controls, including empty vector controls and non-recombinant bacterial strains, to distinguish protein-specific effects from vector-related immune responses .
When facing low expression yields of Recombinant EF_1609, systematic troubleshooting should follow these best practices:
Genetic construct optimization:
Expression strain considerations:
Culture condition optimization:
Test different media compositions (minimal vs. rich media)
Optimize temperature during induction (lower temperatures often improve folding)
Adjust induction timing based on growth phase
Evaluate different inducer concentrations if using inducible promoters
Optimize aeration conditions (shaking speed, culture volume)
Expression detection troubleshooting:
Try alternative protein extraction methods (mechanical vs. enzymatic lysis)
Use different detection antibodies in Western blots
Consider native vs. denaturing conditions for protein analysis
Evaluate cellular fractions separately (membrane, cytoplasmic, secreted)
Check for protein in inclusion bodies if using heterologous systems
Scale and process factors:
Verify pH stability during cultivation
Ensure adequate nutrient availability in scaled-up cultures
Monitor oxygen transfer in larger vessels
Check for metabolite accumulation
Evaluate harvest timing optimization
Systematic approach to optimization:
Implement Design of Experiments (DoE) methodology
Test one variable at a time for initial screening
Use statistical analysis to identify significant factors
Develop predictive models for process optimization
Document all experiments comprehensively
When expressing proteins as cell wall-anchored constructs using CWA sequences or as fusion proteins with targeting peptides like DCpep, additional verification of proper surface display and fusion protein integrity is essential .
Adapting established protocols to study protein-protein interactions involving Recombinant EF_1609 requires systematic modification of standard techniques:
Co-immunoprecipitation (Co-IP) adaptations:
Develop specific antibodies against EF_1609 or utilize fusion tags
Optimize lysis conditions to preserve native interactions
Consider crosslinking before cell disruption to stabilize transient interactions
Use appropriate controls including isotype antibodies and empty vector expressions
Verify results through reciprocal Co-IP experiments
Pull-down assay modifications:
Express EF_1609 with affinity tags (His, GST, MBP) for solid-phase immobilization
Optimize binding and washing buffers to maintain interaction specificity
Consider using site-specific biotinylation for oriented immobilization
Implement stringent controls including unrelated proteins with similar properties
Validate interactions through multiple tag configurations
Surface Plasmon Resonance (SPR) approach:
Immobilize purified EF_1609 on sensor chips using appropriate chemistry
Optimize immobilization density to prevent steric hindrance
Develop regeneration conditions that preserve protein activity
Perform kinetic analyses to determine association/dissociation rates
Conduct competition experiments to confirm binding specificity
Yeast Two-Hybrid (Y2H) system adaptation:
Create fusion constructs with EF_1609 as both bait and prey
Verify proper expression and nuclear localization of fusion proteins
Implement stringent selection conditions to minimize false positives
Validate positive interactions through alternative methods
Consider membrane-based Y2H systems if transmembrane interactions are suspected
Microscopy-based interaction studies:
Develop fluorescent protein fusions for Förster Resonance Energy Transfer (FRET)
Optimize fixation protocols for immunofluorescence studies
Implement Proximity Ligation Assay (PLA) for sensitive detection
Use live-cell imaging to capture dynamic interactions
Quantify co-localization using appropriate statistical methods
Mass spectrometry-based approaches:
Adapt affinity purification-mass spectrometry (AP-MS) protocols
Implement crosslinking MS (XL-MS) to capture transient interactions
Consider hydrogen-deuterium exchange MS for conformational changes
Optimize sample preparation to reduce contaminants
Develop appropriate bioinformatic pipelines for data analysis
When studying proteins expressed in E. faecalis, particularly those displayed on the cell surface through CWA anchoring, additional considerations for membrane preparation and surface accessibility are necessary .
Statistical analysis of immune response data for Recombinant EF_1609 requires careful selection of methods appropriate to the experimental design and data characteristics:
Descriptive statistics foundation:
Calculate means, medians, standard deviations, and confidence intervals
Create appropriate visualizations (box plots, violin plots for distributions)
Assess data normality using Shapiro-Wilk or Kolmogorov-Smirnov tests
Identify and address outliers through established statistical methods
Comparative analysis between groups:
For normally distributed data: t-tests (paired or unpaired) for two groups
For multiple groups: One-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)
For non-parametric data: Mann-Whitney U test (two groups) or Kruskal-Wallis (multiple groups)
For repeated measures: Repeated measures ANOVA or mixed-effects models
Correlation and regression analysis:
Pearson's correlation for linear relationships between normally distributed variables
Spearman's rank correlation for non-parametric associations
Multiple regression to identify predictors of immune response
Principal Component Analysis (PCA) to identify patterns in multivariate data
Advanced statistical approaches:
MANOVA for simultaneous analysis of multiple immune parameters
Linear mixed models for longitudinal data with missing values
Survival analysis for time-to-event data (if applicable)
Machine learning algorithms for complex pattern recognition
Statistical considerations specific to immunological data:
Log-transformation of antibody titers to achieve normality
Arc-sine transformation for percentage data (e.g., cell populations)
Handling censored data from assays with detection limits
Accounting for batch effects in multi-day experiments
Reporting and interpretation guidelines:
Report exact p-values rather than thresholds
Include effect sizes alongside p-values
Present confidence intervals for key measurements
Distinguish between statistical and biological significance
For analyzing complex immunological data from studies involving recombinant E. faecalis expressing proteins like EF_1609, especially when comparing different constructs (e.g., with or without DCpep fusion), appropriate statistical methods are essential to accurately interpret variations in immune parameters across experimental groups .
When faced with contradictory findings regarding Recombinant EF_1609 function, researchers should employ a systematic interpretative framework:
Methodological variance analysis:
Biological context considerations:
Examine differences in bacterial strains used (laboratory vs. commensal E. faecalis)
Consider host factors (species, strain, age, sex, microbiome composition)
Evaluate environmental conditions during experiments
Assess timing of measurements and intervention sequence
Technical validation approach:
Statistical reassessment:
Review statistical methods for appropriateness
Consider sample size and power calculations
Evaluate effect sizes rather than just significance
Assess reproducibility across experimental replicates
Reconciliation strategies:
Develop integrative models that accommodate seemingly contradictory data
Consider condition-dependent functional hypotheses
Propose structure-function relationships that explain context-specific results
Design discriminating experiments to directly test competing hypotheses
Literature context evaluation:
Compare findings with those for related proteins in the UPF0316 family
Review literature on similar recombinant expression systems
Examine parallel results from different bacterial vectors
Consider evolutionary and phylogenetic perspectives
Collaborative resolution approach:
Engage with laboratories reporting contradictory results
Consider joint experiments with standardized protocols
Implement round-robin testing of reagents and samples
Develop community standards for experimental procedures
This systematic approach allows researchers to distinguish between genuine biological complexity and methodological artifacts when interpreting contradictory findings about Recombinant EF_1609 function, particularly in the context of immunological studies where multiple factors can influence outcomes .