Recombinant Enterococcus faecalis UPF0316 protein EF_1609 (EF_1609)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Enterococcus faecalis UPF0316 Protein EF_1609 (EF_1609)

Recombinant Enterococcus faecalis UPF0316 protein EF_1609 (EF_1609) is a protein derived from the bacterium Enterococcus faecalis. This protein is part of the UPF0316 family, which is characterized by its conserved sequence across different species but lacks a well-defined function. The recombinant version of this protein is produced in Escherichia coli and is fused with a His-tag for easier purification and identification.

Characteristics of Recombinant EF_1609 Protein

The recombinant EF_1609 protein is a full-length protein consisting of 183 amino acids. It is expressed in E. coli and purified to a high degree, with a purity of greater than 90% as determined by SDS-PAGE. The protein is provided in a lyophilized form and is recommended to be stored at -20°C or -80°C to maintain its integrity. Reconstitution is typically done in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the option to add glycerol for long-term storage.

CharacteristicsDescription
SpeciesEnterococcus faecalis
SourceE. coli
TagHis-tag
Protein LengthFull Length (1-183 amino acids)
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Amino Acid Sequence of EF_1609

The amino acid sequence of the EF_1609 protein is crucial for understanding its structure and potential functions. The sequence is as follows:

MVVDLKMLAMIFIINFAYITLNTIRFMLTMKGYRVIAPLVSMAEITIYVLGLSMVLNRLD NPLNLLVYALGYAVGISVGIKIEDYLALGYIMVSVILPSTTEQFHLPETLREHGYGVTQS VAYGREGERMVLEILSPRKNERTLYKLINQLEPRAFIISYEPKFISGGFWTKKVRKRNDA ISH.

This sequence provides insights into the protein's structure and potential interactions with other molecules.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
EF_1609; UPF0316 protein EF_1609
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Enterococcus faecalis (strain ATCC 700802 / V583)
Target Names
EF_1609
Target Protein Sequence
MVVDLKMLAMIFIINFAYITLNTIRFMLTMKGYRVIAPLVSMAEITIYVLGLSMVLNRLD NPLNLLVYALGYAVGISVGIKIEDYLALGYIMVSVILPSTTEQFHLPETLREHGYGVTQS VAYGREGERMVLEILSPRKNERTLYKLINQLEPRAFIISYEPKFISGGFWTKKVRKRNDA ISH
Uniprot No.

Target Background

Database Links

KEGG: efa:EF1609

STRING: 226185.EF1609

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Recombinant Enterococcus faecalis UPF0316 protein EF_1609?

The Recombinant Enterococcus faecalis UPF0316 protein EF_1609 belongs to the UPF0316 protein family, which consists of conserved proteins with unknown functions. Structural analysis typically involves expressing the protein in a suitable expression system, purifying it using chromatographic techniques, and then characterizing it using methods such as X-ray crystallography, nuclear magnetic resonance (NMR), or cryo-electron microscopy. When working with recombinant proteins, researchers often utilize bacterial expression systems similar to those described for other E. faecalis proteins, where the plasmid containing the target gene is electrotransformed into the host strain . The purified protein can then be analyzed for secondary structure elements using circular dichroism spectroscopy, which provides information about alpha-helices, beta-sheets, and random coils.

How can I express Recombinant Enterococcus faecalis UPF0316 protein EF_1609 in a laboratory setting?

Expression of Recombinant Enterococcus faecalis UPF0316 protein EF_1609 typically follows a methodological approach similar to other E. faecalis proteins. The general procedure involves:

  • Gene cloning: Amplify the EF_1609 gene without start codon ATG and terminator codon TAA from E. faecalis genomic DNA using PCR.

  • Vector construction: Insert the amplified gene into an expression vector (such as pTX8048) containing appropriate regulatory elements.

  • Transformation: Electrotransform the recombinant plasmid into a suitable E. faecalis strain (such as MDXEF-1 or another laboratory strain) .

  • Protein expression: Induce protein expression under optimal conditions, which typically include specific temperature, media composition, and induction time.

  • Verification: Confirm protein expression using Western blot analysis with appropriate antibodies .

This methodology can be adapted based on specific research requirements, such as anchoring the protein to the cell wall using cell wall anchor (CWA) sequences or expressing it as a fusion protein with specific tags for downstream applications .

What are the common methods for detecting and quantifying Recombinant EF_1609 protein expression?

Detection and quantification of Recombinant EF_1609 protein typically employ multiple complementary techniques:

  • Western blot analysis: This is the gold standard for specific protein detection. The procedure involves protein extraction, SDS-PAGE separation, transfer to a membrane, and immunodetection using antibodies specific to EF_1609 or fusion tags (if applicable) .

  • ELISA (Enzyme-Linked Immunosorbent Assay): For quantitative analysis of the protein in various samples.

  • Flow cytometry: Particularly useful for detecting surface-displayed proteins when EF_1609 is expressed as a cell wall-anchored protein .

  • Mass spectrometry: For precise identification and characterization of the protein and potential post-translational modifications.

  • Fluorescence microscopy: When the protein is fused with fluorescent tags, enabling visualization of its cellular localization.

The choice of method depends on research objectives, available resources, and whether the protein is expressed intracellularly or anchored to the cell wall using CWA sequences .

What are the optimal growth conditions for E. faecalis strains expressing recombinant EF_1609?

Optimal growth conditions for E. faecalis strains expressing recombinant EF_1609 typically require careful optimization of several parameters:

  • Culture medium: Brain Heart Infusion (BHI) broth supplemented with appropriate selective antibiotics based on the resistance markers in the expression vector.

  • Temperature: Standard growth at 37°C, but expression may be optimized at lower temperatures (28-30°C) to enhance proper protein folding.

  • Aeration: E. faecalis is facultatively anaerobic, so cultures can be grown with or without aeration depending on specific strain requirements.

  • pH: Maintain pH between 6.8-7.2 for optimal growth.

  • Induction conditions: If using an inducible promoter system, determine the optimal inducer concentration and induction time.

  • Cell density: Monitor growth by measuring optical density (OD600) and induce expression at the appropriate cell density, typically mid-log phase.

  • Harvest time: Determine the optimal time post-induction for harvesting cells to maximize protein yield while maintaining protein integrity.

Similar approaches have been documented for other recombinant E. faecalis expression systems, where bacteria are typically cultured to a concentration of 5 × 10^9 CFU for experimental applications .

How can I optimize the immunogenicity of Recombinant EF_1609 for vaccine development?

Optimizing the immunogenicity of Recombinant EF_1609 for vaccine development involves several strategic approaches based on established immunological principles:

  • Fusion with immunostimulatory molecules: Consider fusing EF_1609 with dendritic cell-targeting peptides (DCpep) to enhance antigen presentation and immune response. Research has demonstrated that DCpep fusion proteins delivered by probiotic bacteria significantly enhance antigen-induced systemic immune responses .

  • Surface display strategy: Anchor the EF_1609 protein to the bacterial cell surface using cell wall anchor (CWA) sequences. This approach has shown enhanced immunogenicity compared to secreted proteins .

  • Adjuvant selection: Test various adjuvants to determine which best complements EF_1609 immunogenicity.

  • Delivery system optimization: Consider multiple immunization routes (oral, intranasal, parenteral) and regimens. In previous studies with recombinant E. faecalis vaccines, protocols involving three immunizations at 2-week intervals have proven effective .

  • Immune response assessment: Evaluate both humoral and cellular immune responses through:

    • Serum IgG levels via ELISA

    • Secretory IgA levels in mucosal secretions

    • T-cell subpopulations (CD4+ and CD8α+) using flow cytometry

    • Cytokine profiles (particularly IL-2 and IFN-γ) through RT-PCR or ELISA

The immunization schedule should be carefully designed, with preliminary data suggesting a regimen similar to that shown in Table 1.

Table 1: Example Immunization Schedule for Recombinant EF_1609 Vaccine Testing

GroupPrimary Immunization (Days 5-7)Secondary Immunization (Days 21-23)Third Immunization (Days 37-39)Challenge/Assessment (Day 54)
1Recombinant E. faecalis expressing EF_1609 (5 × 10^9 CFU)Recombinant E. faecalis expressing EF_1609 (5 × 10^9 CFU)Recombinant E. faecalis expressing EF_1609 (5 × 10^9 CFU)Immune response assessment
2Recombinant E. faecalis expressing DCpep-EF_1609 (5 × 10^9 CFU)Recombinant E. faecalis expressing DCpep-EF_1609 (5 × 10^9 CFU)Recombinant E. faecalis expressing DCpep-EF_1609 (5 × 10^9 CFU)Immune response assessment
3E. faecalis with empty vector (5 × 10^9 CFU)E. faecalis with empty vector (5 × 10^9 CFU)E. faecalis with empty vector (5 × 10^9 CFU)Immune response assessment
4PBS (pH 7.2)PBS (pH 7.2)PBS (pH 7.2)Immune response assessment

What cellular and molecular mechanisms underlie the immune response to Recombinant EF_1609?

The cellular and molecular mechanisms underlying immune responses to Recombinant EF_1609 involve complex interactions between the innate and adaptive immune systems:

  • Antigen processing and presentation: When EF_1609 is expressed on the surface of E. faecalis or as a fusion protein with DCpep, it can directly interact with dendritic cells (DCs) in the intestinal lamina propria. DCpep has been shown to specifically bind to receptors on DC surfaces, enhancing antigen uptake and presentation .

  • T-cell activation: Following antigen presentation, DCs migrate to lymphoid tissues where they activate:

    • CD4+ T helper cells, which orchestrate downstream immune responses

    • CD8α+ cytotoxic T cells, which provide cell-mediated immunity

    Flow cytometric analysis of peripheral blood lymphocytes can be performed using fluorescein isothiocyanate-conjugated anti-CD4+ and phycoerythrin-conjugated anti-CD8α+ antibodies to quantify these populations .

  • Cytokine production: Activated T cells secrete various cytokines, particularly:

    • IL-2: Promotes T-cell proliferation

    • IFN-γ: Enhances macrophage activation and Th1 responses

    These cytokines can be measured at the mRNA level using RT-PCR or at the protein level using ELISA .

  • Antibody production: B cells produce antigen-specific antibodies:

    • Serum IgG: Provides systemic immunity

    • Secretory IgA: Critical for mucosal immunity, particularly in the intestinal tract

    These antibodies can be quantified using ELISA from serum samples and mucosal lavage respectively .

  • Memory response: Establishment of immunological memory provides long-term protection through memory B and T cells.

Understanding these mechanisms requires comprehensive immunological assessment protocols that measure both cellular and humoral immune components.

How does the vector design influence the expression efficiency and immunogenicity of Recombinant EF_1609?

Vector design significantly impacts both expression efficiency and immunogenicity of Recombinant EF_1609 through multiple factors:

  • Promoter selection: The strength and regulation of the promoter determine expression levels. Constitutive promoters provide continuous expression, while inducible promoters offer controlled expression.

  • Signal peptide optimization: The signal peptide sequence (SP) directs protein secretion or anchoring. Optimizing this element can significantly improve protein translocation efficiency .

  • Cell wall anchoring domains: Incorporating cell wall anchor (CWA) sequences enables surface display of EF_1609, which generally enhances immunogenicity compared to secreted forms. The CWA from Gram-positive bacteria typically contains LPXTG motifs recognized by sortase enzymes that covalently attach the protein to peptidoglycan .

  • Fusion partners: Strategic fusion with immunostimulatory molecules like DCpep can enhance targeted delivery to immune cells. Research has demonstrated that DCpep fusion proteins specifically bind to receptors on dendritic cell surfaces, increasing antigen uptake and presentation efficiency .

  • Codon optimization: Adapting the coding sequence to the codon usage bias of E. faecalis can significantly improve translation efficiency and protein yield.

  • Vector backbone elements: Selection of appropriate origin of replication, antibiotic resistance markers, and transcriptional terminators impacts plasmid stability and expression levels.

  • Removal of unnecessary elements: Eliminating start codons (ATG) and terminator codons (TAA) from the target gene when designing fusion constructs ensures proper expression of the complete fusion protein .

Experimental data have shown that recombinant E. faecalis expressing DCpep-fusion proteins elicits significantly stronger immune responses compared to those expressing the target protein alone, with higher levels of serum IgG, secretory IgA, CD4+/CD8+ T-cell populations, and cytokine expression .

What are the critical parameters for evaluating the stability and functionality of purified Recombinant EF_1609?

Evaluating the stability and functionality of purified Recombinant EF_1609 requires comprehensive analysis of several critical parameters:

  • Protein integrity assessment:

    • SDS-PAGE for molecular weight confirmation and purity evaluation

    • Western blot for identity verification using specific antibodies

    • Mass spectrometry for precise molecular weight determination and detection of post-translational modifications

    • N-terminal sequencing to confirm correct processing of the signal peptide

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Dynamic light scattering to assess homogeneity and aggregation state

    • Thermal shift assays to determine thermal stability (Tm)

  • Functional analysis:

    • Binding assays to evaluate interaction with target receptors (particularly important for DCpep fusion proteins)

    • Immunological assays to assess antigenicity and immunogenicity

    • Cell-based assays to determine biological activity

  • Stability studies:

    • Accelerated stability testing under various conditions (temperature, pH, ionic strength)

    • Long-term stability assessment during storage

    • Freeze-thaw stability to determine appropriate handling procedures

    • Aggregation propensity using techniques like size exclusion chromatography

  • Quality control parameters:

    • Endotoxin testing using Limulus Amebocyte Lysate (LAL) assay

    • Host cell protein (HCP) quantification

    • Residual DNA quantification

    • Sterility testing

For recombinant proteins intended for immunological studies, functional characterization should include verification of proper display on bacterial surfaces when using CWA anchoring systems, as well as confirmation of specific binding to target immune cells when incorporating targeting peptides like DCpep .

How can contradictory data regarding the immunological effects of Recombinant EF_1609 be reconciled and analyzed?

Reconciling and analyzing contradictory data regarding the immunological effects of Recombinant EF_1609 requires a systematic approach:

  • Methodological standardization analysis:

    • Compare experimental protocols in detail, including bacterial strain selection, vector design, culture conditions, and purification methods

    • Standardize immunization protocols, including dose, route, adjuvants, and schedule

    • Ensure consistent methods for immune response assessment

  • Strain and expression system variation assessment:

    • Analyze differences between E. faecalis strains used (laboratory vs. commensal isolates)

    • Compare protein localization (secreted vs. surface-anchored) as this significantly impacts immunogenicity

    • Evaluate fusion partners and their influence on immune responses

  • Host factors consideration:

    • Analyze genetic background of experimental animals

    • Compare age, sex, and microbiome composition of test subjects

    • Consider pre-existing immunity to E. faecalis

  • Statistical rigor evaluation:

    • Assess sample sizes and power calculations

    • Review statistical methods and significance thresholds

    • Consider biological vs. statistical significance

  • Integrated data analysis:

    • Perform meta-analysis when sufficient comparable studies exist

    • Use systems biology approaches to integrate transcriptomic, proteomic, and immunological data

    • Develop mathematical models to predict immune responses based on experimental variables

  • Validation experiments design:

    • Conduct side-by-side comparisons under identical conditions

    • Include comprehensive controls (such as empty vector controls and PBS controls)

    • Perform dose-response studies to identify optimal conditions

  • Mechanistic investigations:

    • Analyze specific immune cell populations using flow cytometry

    • Measure both Th1 and Th2 cytokine profiles

    • Evaluate mucosal vs. systemic immune responses separately

Research has demonstrated that multiple factors, including fusion with DCpep, can significantly alter the immunological profile of recombinant proteins expressed in E. faecalis, resulting in enhanced CD4+ and CD8+ T-cell responses and elevated cytokine production .

What are the optimal experimental designs for evaluating the effect of Recombinant EF_1609 on host immune response?

Designing experiments to evaluate the effect of Recombinant EF_1609 on host immune response requires careful consideration of multiple factors:

  • Experimental groups design:

    • Test group: E. faecalis expressing EF_1609

    • Enhanced test group: E. faecalis expressing DCpep-EF_1609 fusion protein

    • Vector control group: E. faecalis containing empty vector

    • Negative control group: PBS-treated

    • Positive control group (if applicable): Known immunostimulatory agent

  • Immunization protocol:

    • Route: Oral administration is typically used for intestinal immune response studies with E. faecalis

    • Dosage: Standardized bacterial concentrations (5 × 10^9 CFU per dose)

    • Schedule: Primary immunization followed by boosters at 2-week intervals

    • Duration: Typically three immunization cycles over 4-6 weeks

  • Immune response assessment timeline:

    • Pre-immunization baseline measurements

    • Post-primary immunization (day 14)

    • Post-secondary immunization (day 35)

    • Post-tertiary immunization (day 49)

    • Long-term immunity assessment (optional)

  • Comprehensive immune profiling:

    • Humoral immunity: Serum IgG and mucosal secretory IgA levels via ELISA

    • Cellular immunity: Flow cytometric analysis of CD4+ and CD8α+ T-cell populations

    • Cytokine profiling: RT-PCR for IL-2, IFN-γ, and other relevant cytokines

    • Functional assays: Lymphocyte proliferation in response to antigen re-stimulation

  • Statistical analysis plan:

    • Sample size calculation based on expected effect size

    • Appropriate statistical tests for each data type

    • Multiple comparison corrections

    • Reporting of effect sizes alongside p-values

This experimental design allows for comprehensive evaluation of both the magnitude and quality of immune responses induced by Recombinant EF_1609, while controlling for vector-specific effects and natural immune fluctuations.

How can I design experiments to compare the efficiency of different expression systems for Recombinant EF_1609?

Designing comparative experiments for different expression systems of Recombinant EF_1609 requires a systematic approach:

This approach enables objective comparison of different expression systems while accounting for system-specific requirements, ultimately facilitating selection of the optimal system for EF_1609 production based on research or application needs.

What are the most effective approaches for studying the structure-function relationship of Recombinant EF_1609?

Investigating the structure-function relationship of Recombinant EF_1609 requires an integrated approach combining structural biology techniques with functional assays:

When studying recombinant proteins expressed in E. faecalis, considering the impact of cell wall anchoring domains and fusion partners (like DCpep) on structure and function is particularly important, as these elements can significantly influence protein conformation and accessibility .

How can Recombinant EF_1609 be used as a research tool in immunological studies?

Recombinant EF_1609 can be utilized as a versatile research tool in immunological studies through several applications:

  • Antigen delivery system development:

    • As a model protein for testing various display strategies in E. faecalis

    • For studying mechanisms of protein presentation to the immune system

    • In comparative studies between different bacterial vectors

  • Adjuvant research platform:

    • For testing novel adjuvant combinations

    • In studying mucosal immune responses

    • As a carrier for heterologous epitopes

  • Dendritic cell targeting research:

    • When fused with DCpep, for investigating DC-specific targeting mechanisms

    • For studying the influence of targeting on antigen presentation pathways

    • In evaluating differences between various DC subpopulations

  • Immune response mechanism studies:

    • For analyzing T-cell activation pathways

    • In investigating mucosal IgA induction mechanisms

    • For studying innate immune recognition of bacterial components

  • Vaccine platform development:

    • As a model antigen in novel vaccine delivery systems

    • For testing prime-boost strategies

    • In developing mucosal vaccination approaches

  • Methodological applications:

    • Protocol development for lymphocyte isolation and characterization

    • Optimization of flow cytometry panels for immune cell phenotyping

    • Refinement of techniques for cytokine measurement

  • Experimental control applications:

    • As a standardized positive control in immunological assays

    • For validating new immunological techniques

    • In training exercises for technical personnel

When used as a research tool, it's important to implement comprehensive controls, including empty vector controls and non-recombinant bacterial strains, to distinguish protein-specific effects from vector-related immune responses .

What are the best practices for troubleshooting low expression yields of Recombinant EF_1609?

When facing low expression yields of Recombinant EF_1609, systematic troubleshooting should follow these best practices:

  • Genetic construct optimization:

    • Verify sequence integrity through complete sequencing

    • Check for rare codons and consider codon optimization

    • Examine the ribosome binding site (RBS) strength and spacing

    • Ensure proper signal peptide function if secretion is desired

    • Verify compatibility of fusion tags with the target protein

  • Expression strain considerations:

    • Evaluate alternative E. faecalis strains (beyond MDXEF-1)

    • Assess plasmid stability through multiple generations

    • Check for potential toxicity of the expressed protein

    • Verify antibiotic selection pressure is maintained

    • Consider protease-deficient strains if degradation is suspected

  • Culture condition optimization:

    • Test different media compositions (minimal vs. rich media)

    • Optimize temperature during induction (lower temperatures often improve folding)

    • Adjust induction timing based on growth phase

    • Evaluate different inducer concentrations if using inducible promoters

    • Optimize aeration conditions (shaking speed, culture volume)

  • Expression detection troubleshooting:

    • Try alternative protein extraction methods (mechanical vs. enzymatic lysis)

    • Use different detection antibodies in Western blots

    • Consider native vs. denaturing conditions for protein analysis

    • Evaluate cellular fractions separately (membrane, cytoplasmic, secreted)

    • Check for protein in inclusion bodies if using heterologous systems

  • Scale and process factors:

    • Verify pH stability during cultivation

    • Ensure adequate nutrient availability in scaled-up cultures

    • Monitor oxygen transfer in larger vessels

    • Check for metabolite accumulation

    • Evaluate harvest timing optimization

  • Systematic approach to optimization:

    • Implement Design of Experiments (DoE) methodology

    • Test one variable at a time for initial screening

    • Use statistical analysis to identify significant factors

    • Develop predictive models for process optimization

    • Document all experiments comprehensively

When expressing proteins as cell wall-anchored constructs using CWA sequences or as fusion proteins with targeting peptides like DCpep, additional verification of proper surface display and fusion protein integrity is essential .

How can I adapt established protocols to study protein-protein interactions involving Recombinant EF_1609?

Adapting established protocols to study protein-protein interactions involving Recombinant EF_1609 requires systematic modification of standard techniques:

  • Co-immunoprecipitation (Co-IP) adaptations:

    • Develop specific antibodies against EF_1609 or utilize fusion tags

    • Optimize lysis conditions to preserve native interactions

    • Consider crosslinking before cell disruption to stabilize transient interactions

    • Use appropriate controls including isotype antibodies and empty vector expressions

    • Verify results through reciprocal Co-IP experiments

  • Pull-down assay modifications:

    • Express EF_1609 with affinity tags (His, GST, MBP) for solid-phase immobilization

    • Optimize binding and washing buffers to maintain interaction specificity

    • Consider using site-specific biotinylation for oriented immobilization

    • Implement stringent controls including unrelated proteins with similar properties

    • Validate interactions through multiple tag configurations

  • Surface Plasmon Resonance (SPR) approach:

    • Immobilize purified EF_1609 on sensor chips using appropriate chemistry

    • Optimize immobilization density to prevent steric hindrance

    • Develop regeneration conditions that preserve protein activity

    • Perform kinetic analyses to determine association/dissociation rates

    • Conduct competition experiments to confirm binding specificity

  • Yeast Two-Hybrid (Y2H) system adaptation:

    • Create fusion constructs with EF_1609 as both bait and prey

    • Verify proper expression and nuclear localization of fusion proteins

    • Implement stringent selection conditions to minimize false positives

    • Validate positive interactions through alternative methods

    • Consider membrane-based Y2H systems if transmembrane interactions are suspected

  • Microscopy-based interaction studies:

    • Develop fluorescent protein fusions for Förster Resonance Energy Transfer (FRET)

    • Optimize fixation protocols for immunofluorescence studies

    • Implement Proximity Ligation Assay (PLA) for sensitive detection

    • Use live-cell imaging to capture dynamic interactions

    • Quantify co-localization using appropriate statistical methods

  • Mass spectrometry-based approaches:

    • Adapt affinity purification-mass spectrometry (AP-MS) protocols

    • Implement crosslinking MS (XL-MS) to capture transient interactions

    • Consider hydrogen-deuterium exchange MS for conformational changes

    • Optimize sample preparation to reduce contaminants

    • Develop appropriate bioinformatic pipelines for data analysis

When studying proteins expressed in E. faecalis, particularly those displayed on the cell surface through CWA anchoring, additional considerations for membrane preparation and surface accessibility are necessary .

What statistical approaches are most appropriate for analyzing immune response data related to Recombinant EF_1609?

Statistical analysis of immune response data for Recombinant EF_1609 requires careful selection of methods appropriate to the experimental design and data characteristics:

  • Descriptive statistics foundation:

    • Calculate means, medians, standard deviations, and confidence intervals

    • Create appropriate visualizations (box plots, violin plots for distributions)

    • Assess data normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Identify and address outliers through established statistical methods

  • Comparative analysis between groups:

    • For normally distributed data: t-tests (paired or unpaired) for two groups

    • For multiple groups: One-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • For non-parametric data: Mann-Whitney U test (two groups) or Kruskal-Wallis (multiple groups)

    • For repeated measures: Repeated measures ANOVA or mixed-effects models

  • Correlation and regression analysis:

    • Pearson's correlation for linear relationships between normally distributed variables

    • Spearman's rank correlation for non-parametric associations

    • Multiple regression to identify predictors of immune response

    • Principal Component Analysis (PCA) to identify patterns in multivariate data

  • Advanced statistical approaches:

    • MANOVA for simultaneous analysis of multiple immune parameters

    • Linear mixed models for longitudinal data with missing values

    • Survival analysis for time-to-event data (if applicable)

    • Machine learning algorithms for complex pattern recognition

  • Statistical considerations specific to immunological data:

    • Log-transformation of antibody titers to achieve normality

    • Arc-sine transformation for percentage data (e.g., cell populations)

    • Handling censored data from assays with detection limits

    • Accounting for batch effects in multi-day experiments

  • Reporting and interpretation guidelines:

    • Report exact p-values rather than thresholds

    • Include effect sizes alongside p-values

    • Present confidence intervals for key measurements

    • Distinguish between statistical and biological significance

For analyzing complex immunological data from studies involving recombinant E. faecalis expressing proteins like EF_1609, especially when comparing different constructs (e.g., with or without DCpep fusion), appropriate statistical methods are essential to accurately interpret variations in immune parameters across experimental groups .

How should researchers interpret contradictory findings when analyzing the function of Recombinant EF_1609?

When faced with contradictory findings regarding Recombinant EF_1609 function, researchers should employ a systematic interpretative framework:

  • Methodological variance analysis:

    • Scrutinize experimental protocols for subtle differences in procedures

    • Compare protein expression systems and purification methods

    • Evaluate differences in fusion constructs and targeting strategies

    • Assess variation in experimental readouts and analytical techniques

  • Biological context considerations:

    • Examine differences in bacterial strains used (laboratory vs. commensal E. faecalis)

    • Consider host factors (species, strain, age, sex, microbiome composition)

    • Evaluate environmental conditions during experiments

    • Assess timing of measurements and intervention sequence

  • Technical validation approach:

    • Verify protein expression and localization through multiple methods

    • Confirm antibody specificity and detection limits

    • Validate key findings using complementary techniques

    • Implement rigorous controls at each experimental stage

  • Statistical reassessment:

    • Review statistical methods for appropriateness

    • Consider sample size and power calculations

    • Evaluate effect sizes rather than just significance

    • Assess reproducibility across experimental replicates

  • Reconciliation strategies:

    • Develop integrative models that accommodate seemingly contradictory data

    • Consider condition-dependent functional hypotheses

    • Propose structure-function relationships that explain context-specific results

    • Design discriminating experiments to directly test competing hypotheses

  • Literature context evaluation:

    • Compare findings with those for related proteins in the UPF0316 family

    • Review literature on similar recombinant expression systems

    • Examine parallel results from different bacterial vectors

    • Consider evolutionary and phylogenetic perspectives

  • Collaborative resolution approach:

    • Engage with laboratories reporting contradictory results

    • Consider joint experiments with standardized protocols

    • Implement round-robin testing of reagents and samples

    • Develop community standards for experimental procedures

This systematic approach allows researchers to distinguish between genuine biological complexity and methodological artifacts when interpreting contradictory findings about Recombinant EF_1609 function, particularly in the context of immunological studies where multiple factors can influence outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.