Recombinant Enterococcus phage phiEF24C Putative major capsid protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Putative major capsid protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-464
Protein Length
full length protein
Species
Enterococcus phage phiEF24C (Enterococcus bacteriophage phi-EF24C)
Target Protein Sequence
GFTTGYGITPESQTDAAALRREFLDDQITMLTWADGDLSFYRDITKRPATSTVAKYDVYL AHGRVGHTRFTREIGVAPISDPNLRQKTVNMKYVSDTKNMSIATGLVNNIEDPMRILTDD AISVVAKTIEWASFYGDSDLSENPDAGSGLEFDGLAKLIDKHNVLDAKGASLTEALLNQA SVLVGKGYGTPTDAYMPIGVQADFVNQQLDRQVQVISDNGQNATMGFNVKGFNSARGFIR LHGSTVMELEQILDENRMQLPNAPQKATVKATLEAGTKGKFRDEDLTIDTEYKVVVVSDD AESAPSDVASVVIDDKKKQVKLEITINNMYQARPQYVAIYRKGLETGLFYQIARVPASKA VEGVITFIDVNDEIPETADVFVGELTPSVVHLFELLPMMRLPLAQVNASVTFAVLWYGAL ALRAPKKWARIKNVKYIATGNVFN
Uniprot No.

Target Background

Database Links

KEGG: vg:5666484

Subcellular Location
Virion. Host membrane; Single-pass membrane protein.

Q&A

What is phage phiEF24C and why is it significant for research?

Phage phiEF24C is a virulent bacteriophage isolated from the environment that specifically targets Enterococcus faecalis, including vancomycin-resistant strains (VRE). Its significance stems from its broad host range, effective lytic activity, and potential applications in phage therapy. The phage possesses distinctive characteristics including a shorter latent period and larger burst size compared to ordinary tailed phages, making it particularly effective against many E. faecalis strains . As antibiotic resistance continues to pose significant challenges in clinical settings, phiEF24C represents a promising alternative therapeutic approach against enterococcal infections.

How was phiEF24C initially isolated and characterized?

PhiEF24C was identified during an environmental screening process where 30 Enterococcus faecalis phages were isolated. Among these, phiEF24C stood out due to its broad host range and was selected for further analysis . Initial characterization involved determining its plaque-forming abilities against different clinical host strains, measuring its latent period and burst size, and performing morphological analysis. Genomic characterization revealed it belongs to the Myoviridae family (morphotype A1) with a linear double-stranded DNA genome of approximately 143 kbp . Protein analysis included examination of N-terminal amino acid sequences of virion proteins, which helped establish its relationship to other myoviruses that infect Gram-positive bacteria.

What are the genomic features of phiEF24C?

The complete genome of phiEF24C consists of 142,072 base pairs encoding 221 open reading frames (ORFs) and five tRNA genes . Bioinformatic analysis revealed no genes encoding undesirable proteins for phage therapy, such as toxins or integration-related proteins. The genome organization shows non-competitive directions of replication and transcription, and evidence of host-adapted translation mechanisms . These genomic characteristics place phiEF24C in the SPO1-like phage genus, with particularly close relationships to Listeria phage P100, which has already been authorized for prophylactic use in food safety applications . The genome has been fully sequenced and analyzed to confirm its therapeutic eligibility.

What is known about the structure of phiEF24C major capsid protein?

While detailed structural information specific to phiEF24C's major capsid protein is limited in current research, comparison with related phages provides valuable insights. As a member of the Myoviridae family, phiEF24C likely possesses a major capsid protein with structural similarities to other myoviruses infecting Gram-positive bacteria . The protein would be expected to form the icosahedral head structure that protects the viral genome. Comparative analysis with related Enterococcus phages like EFLK1, ECP3, and EFDG1 suggests conservation of capsid protein structure among this group . Detailed structural characterization would require techniques such as X-ray crystallography or cryo-electron microscopy to resolve the three-dimensional conformation.

What are the recommended protocols for recombinant expression of phiEF24C major capsid protein?

Based on established methods for similar phage proteins, recombinant expression of phiEF24C major capsid protein would typically involve:

  • Gene cloning: Amplification of the capsid gene from phiEF24C genomic DNA using PCR with specific primers designed based on the annotated genome sequence.

  • Expression vector construction: Insertion into an appropriate expression vector (pET systems are commonly used) with a purification tag (His6, GST, etc.).

  • Expression conditions: Transformation into E. coli expression strains (BL21(DE3) or derivatives) with protein expression typically induced using IPTG at concentrations of 0.1-1.0 mM.

  • Optimization parameters: Key variables include induction temperature (typically 16-37°C), duration (4-24 hours), and media composition (standard LB or enriched media like TB).

For improved solubility, expression at lower temperatures (16-25°C) with longer induction times is often beneficial for phage structural proteins. Purification typically employs affinity chromatography followed by size exclusion chromatography to obtain homogeneous protein samples .

What analytical techniques are most effective for characterizing the purified major capsid protein?

The characterization of purified major capsid protein should employ multiple complementary techniques:

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to determine secondary structure composition (α-helices, β-sheets)

    • Dynamic light scattering (DLS) to assess homogeneity and oligomerization state

    • Small-angle X-ray scattering (SAXS) for low-resolution structural information

  • Biophysical characterization:

    • Differential scanning calorimetry (DSC) to determine thermal stability

    • Isothermal titration calorimetry (ITC) to study binding interactions

    • Cross-linking experiments to examine oligomerization potential

  • Proteomic analysis:

    • Mass spectrometry (particularly LC-MS/MS) for protein identification and post-translational modifications

    • N-terminal sequencing to confirm the correct processing

Similar approaches have been successfully applied to other phage capsid proteins, such as the FIV capsid protein, which was characterized using CD, ITC, and DLS to determine that it consists primarily of α-helices and exhibits concentration-dependent dimerization .

How does the P2 mutation affect capsid assembly and phage infectivity?

The P2 mutation, identified in phiEF24C, is located in Orf31, which encodes a putative tail fiber protein rather than a capsid component. This mutation significantly enhances phage adsorption and cell lysis capabilities . Interestingly, related phages (EFDG1, EFLK1, and ECP3) contain homologs of Orf31 but lack the specific P2 mutant allele .

  • Whether structural modifications in the major capsid protein could compensate for the absence of the P2 mutation

  • How capsid-tail interactions might be optimized when engineering recombinant phages

  • Whether the enhanced adsorption conferred by the P2 mutation affects the structural stability requirements of the capsid

These questions are particularly relevant when considering phiEF24C as a therapeutic agent, as modifications that enhance infectivity without compromising structural integrity could improve therapeutic outcomes .

What role does the major capsid protein play in phage resistance mechanisms?

Understanding how bacteria develop resistance to phages is crucial for therapeutic applications. The major capsid protein, while not directly involved in host recognition, may influence resistance mechanisms through:

  • Stability against bacterial proteases: Resistant bacteria may upregulate protease production that targets phage structural proteins.

  • Immune evasion capabilities: When used therapeutically, the capsid must withstand both bacterial and host defense mechanisms.

  • Structural adaptation: Sequential evolution experiments show phages can modify structural proteins to overcome resistance.

Research with related phages demonstrates that bacterial resistance to one phage (EFDG1) can be overcome by another phage (EFLK1), suggesting structural differences in capsid and tail proteins may provide complementary infection mechanisms . This complementarity forms the basis for effective phage cocktail development against resistant strains. When EFDG1 and EFLK1 were combined, they showed an additive effect against E. faecalis strains regardless of their antibiotic or phage-resistance profile .

How can in silico modeling improve our understanding of phiEF24C capsid assembly?

Advanced computational approaches can significantly enhance our understanding of the phiEF24C capsid structure and assembly process through:

  • Homology modeling: Using solved structures of related phage capsid proteins as templates to predict the three-dimensional structure of phiEF24C's major capsid protein.

  • Molecular dynamics simulations: Investigating the stability, flexibility, and conformational changes of the capsid protein under different conditions.

  • Protein-protein docking: Predicting interactions between capsid subunits during assembly.

  • Machine learning approaches: Identifying patterns in capsid protein sequences that correlate with functional properties.

These computational methods can guide experimental design by identifying:

  • Key residues for mutagenesis studies

  • Potential interface regions for protein-protein interactions

  • Structural determinants of stability and assembly efficiency

Such in silico analysis has proven valuable in related research, such as the comparative genomic analysis that identified the evolutionary relationships between phiEF24C and other therapeutic phages .

How does phiEF24C major capsid protein compare to other Enterococcus phages?

Comparative analysis of phiEF24C with related Enterococcus phages reveals significant insights into capsid protein evolution and function:

*Although φB124-14 infects Bacteroides rather than Enterococcus, its proteomic characterization provides a valuable model for capsid protein identification .

What can we learn from proteomics studies of related phage capsid proteins?

Proteomics approaches have proven valuable for identifying and characterizing phage structural proteins. For example, in φB124-14, tandem mass spectrometry confirmed the presence of ORF38 (major capsid protein 1) and ORF42 (major protein 2) in mature virions and additionally identified ORF39 (previously hypothetical) as a capsid component .

Similar methodologies could be applied to phiEF24C to:

  • Confirm predicted capsid proteins: Verify bioinformatic predictions through direct protein identification

  • Identify post-translational modifications: Detect modifications that may affect capsid assembly or stability

  • Discover novel structural components: Identify previously unannotated proteins present in mature virions

  • Quantify protein stoichiometry: Determine the relative abundance of different capsid components

What are the main challenges in developing recombinant versions of phiEF24C major capsid protein?

Researchers face several significant challenges when working with recombinant phiEF24C major capsid protein:

  • Expression and solubility issues: Viral structural proteins often form inclusion bodies or aggregate during recombinant expression, requiring optimization of expression conditions or refolding protocols.

  • Structural integrity: Ensuring recombinant proteins maintain native conformations and assembly properties.

  • Functional assessment: Developing assays to verify that recombinant capsid proteins retain the ability to assemble into virus-like particles.

  • Scale-up considerations: Transitioning from analytical to preparative quantities while maintaining protein quality.

These challenges necessitate systematic optimization approaches, including:

  • Screening multiple expression systems (bacterial, yeast, insect, mammalian)

  • Testing various solubility and purification tags

  • Exploring chaperone co-expression strategies

  • Developing refolding protocols if proteins express in inclusion bodies

How might phiEF24C major capsid protein be engineered for enhanced therapeutic applications?

Advanced protein engineering approaches could enhance the therapeutic potential of phiEF24C through targeted modifications:

  • Stability engineering: Introducing mutations that enhance thermal or chemical stability without compromising assembly.

  • Immunomodulation: Modifying surface-exposed epitopes to reduce immunogenicity for repeated therapeutic use.

  • Targeting capabilities: Adding tissue-specific targeting peptides to the capsid surface for directed delivery.

  • Cargo capacity: Engineering the internal space of assembled capsids to carry therapeutic payloads.

Potential engineering strategies include:

  • Rational design based on structural information

  • Directed evolution to select variants with desired properties

  • Chimeric approaches incorporating beneficial features from related phages

Such engineering efforts would build upon the established therapeutic potential of phiEF24C, which has already demonstrated effectiveness in mouse models of sepsis without inducing adverse effects under both single and repeated exposures .

What role could structural biology play in advancing phiEF24C research?

High-resolution structural biology techniques would significantly advance understanding of phiEF24C capsid architecture and function:

  • Cryo-electron microscopy (cryo-EM): Could resolve the entire capsid structure at near-atomic resolution, revealing the arrangement of protein subunits and capsid symmetry.

  • X-ray crystallography: While challenging for large assemblies, could provide atomic-level details of individual capsid proteins or domains.

  • Nuclear magnetic resonance (NMR): Suitable for studying dynamic regions or smaller domains of the capsid protein.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Could map protein flexibility and assembly interfaces.

These approaches would address critical knowledge gaps:

  • The mechanism of capsid assembly and maturation

  • Structural determinants of host specificity

  • Conformational changes during infection

  • Rational targets for protein engineering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.