Recombinant Episoriculus fumidus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Episoriculus fumidus (Taiwan brown-toothed shrew) (Soriculus fumidus)
Target Names
Target Protein Sequence
MSLVHMNIGLAFTVAFLGLLMYRSHLMSSLLCLEGMMLTLFIMSSIMVLNMHFTLASMLP IILLVFAACEAAVGLSLLVMVSNTYGVDYVQNLNLLQC
Uniprot No.

Target Background

Function
The protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of MT-ND4L in mitochondrial function?

MT-ND4L (mitochondrially encoded NADH 4L dehydrogenase) is a core subunit of mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein plays a critical role in the first step of the electron transport process, transferring electrons from NADH to ubiquinone. It is part of the enzyme membrane arm embedded in the lipid bilayer and is directly involved in proton translocation across the inner mitochondrial membrane .

The protein functions within Complex I to create an unequal electrical charge on either side of the inner mitochondrial membrane through the step-by-step transfer of electrons. This difference in electrical charge provides the essential energy for ATP production through oxidative phosphorylation .

What is the typical amino acid sequence length of Episoriculus fumidus MT-ND4L?

While the search results don't specifically provide the amino acid sequence for Episoriculus fumidus MT-ND4L, we can compare it to related species. For reference, a comparable protein from the same mitochondrial complex in Episoriculus fumidus, the MT-ND6, has a full-length sequence of 178 amino acids . In other mammalian species, MT-ND4L typically consists of 90-100 amino acids, as evidenced by the sequence information from Presbytis melalophos MT-ND4L .

What are effective methods for producing recombinant Episoriculus fumidus MT-ND4L?

Based on protocols used for similar mitochondrial proteins, effective production of recombinant Episoriculus fumidus MT-ND4L typically involves:

  • Gene cloning: Amplify the MT-ND4L gene from Episoriculus fumidus mtDNA using PCR with specific primers.

  • Expression vector construction: Insert the gene into an appropriate expression vector (such as pET series) with a His-tag for purification.

  • Host selection: Express in E. coli strains optimized for membrane proteins (e.g., C41(DE3) or C43(DE3)).

  • Culture conditions: Grow at lower temperatures (16-25°C) after induction to improve proper folding.

  • Purification strategy: Use affinity chromatography with Ni-NTA resin followed by size exclusion chromatography.

For optimal results, express the protein with appropriate detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin to maintain membrane protein solubility and structural integrity .

What approaches can researchers use to verify the functional activity of recombinant MT-ND4L?

Verifying the functional activity of recombinant MT-ND4L requires multiple complementary approaches:

  • NADH oxidation assay: Measure the rate of NADH oxidation spectrophotometrically at 340 nm in the presence of ubiquinone analogues.

  • Oxygen consumption measurements: Assess respiratory activity using oxygen electrode measurements with isolated mitochondria or reconstituted proteoliposomes.

  • Complex I assembly analysis: Use blue native PAGE to determine if the recombinant protein correctly incorporates into Complex I.

  • Electron transfer activity: Measure electron transfer from NADH to artificial electron acceptors like ferricyanide.

  • Proton pumping assays: Monitor pH changes in proteoliposomes containing reconstituted recombinant protein using pH-sensitive fluorescent dyes.

Research has shown that mouse embryonic fibroblast (MEF) cell lines with mutations in mitochondrial Complex I genes show significantly lower oxygen consumption rates compared to wild-type MEFs, demonstrating impaired ATP synthesis due to mitochondrial dysfunction .

How conserved is MT-ND4L across mammalian species, and what implications does this have for research using Episoriculus fumidus MT-ND4L?

When comparing MT-ND4L sequences between species:

SpeciesSequence LengthNotable FeaturesUniProt ID
Presbytis melalophos98 aaCore subunit of Complex IQ15GP7
Phalanger vestitusSimilar lengthInvolved in proton translocationQ1MWD9
Human98 aaAssociated with Leber hereditary optic neuropathyVarious

These variations reflect evolutionary adaptations while maintaining core functionality. Researchers using Episoriculus fumidus MT-ND4L should consider these cross-species similarities and differences when designing experiments and interpreting results .

What genomic features characterize the MT-ND4L gene in Episoriculus fumidus?

The MT-ND4L gene in mammals, including Episoriculus fumidus, is located on mitochondrial DNA. Key genomic features include:

  • Genome location: The gene is encoded in the mitochondrial genome, not the nuclear genome.

  • Exon structure: Unlike nuclear genes, MT-ND4L typically lacks introns.

  • Conserved regions: Contains highly conserved domains essential for NADH dehydrogenase activity.

  • Transcription: Co-transcribed with other mitochondrial genes as part of a polycistronic transcript.

  • Regulation: Expression is regulated by both nuclear and mitochondrial factors.

The MT-ND4L gene is affected by the higher mutation rate characteristic of mitochondrial DNA compared to nuclear DNA, which may result in species-specific variants that affect protein function and potentially contribute to adaptations to specific environmental conditions .

How are mutations in MT-ND4L associated with human diseases, and what relevance might this have for research using Episoriculus fumidus MT-ND4L?

Mutations in human MT-ND4L have been associated with several mitochondrial disorders, most notably Leber hereditary optic neuropathy (LHON). The T10663C (Val65Ala) mutation has been identified in several families with LHON .

This mutation changes a single amino acid (valine to alanine) at position 65 of the protein, disrupting the normal activity of Complex I in the mitochondrial inner membrane. This leads to vision loss characteristic of LHON through mechanisms that are still being investigated .

Research using Episoriculus fumidus MT-ND4L can provide comparative insights into how structural variations in this protein might affect susceptibility to mitochondrial disorders across species, potentially revealing conserved functional domains critical for normal activity that could serve as therapeutic targets.

What experimental approaches can be used to study the effects of MT-ND4L mutations on mitochondrial function?

Several experimental approaches are effective for studying the impact of MT-ND4L mutations:

  • Heteroplasmic mouse models: Generate mice with varying levels of mutant mtDNA to study tissue-specific effects.

  • Oxygen consumption analysis: Measure the impact of mutations on cellular respiration using instruments like Seahorse XF Analyzers.

  • ATP production assays: Quantify ATP levels in tissue lysates from wild-type versus mutant models.

  • Transmission electron microscopy: Visualize mitochondrial structural changes, particularly cristae morphology.

  • Temperature challenge tests: Expose models to cold environments to assess thermogenic capacity.

  • Metabolic studies: Conduct indirect calorimetry tests to assess oxygen consumption and CO₂ production rates.

Studies have shown that mitochondrial gene knockout mice exhibit decreased ATP production, damaged mitochondrial cristae, and impaired thermoregulation, highlighting the systemic effects of mitochondrial dysfunction .

What structural analysis techniques are most effective for studying the conformation of MT-ND4L within Complex I?

Several advanced structural biology techniques are particularly effective for studying MT-ND4L:

  • Cryo-electron microscopy (cryo-EM): Provides high-resolution structures of membrane protein complexes like Complex I without requiring crystallization.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies solvent-accessible regions and conformational changes in the protein.

  • Cross-linking mass spectrometry (XL-MS): Maps spatial relationships between MT-ND4L and other subunits of Complex I.

  • Single-particle analysis: Enables visualization of different conformational states of Complex I.

  • Molecular dynamics simulations: Models protein dynamics and conformational changes in membrane environments.

  • AI-driven conformational ensemble generation: Uses advanced algorithms to predict alternative functional states of the protein along "soft" collective coordinates .

The combination of these techniques provides comprehensive insights into how MT-ND4L functions within the larger Complex I structure and how mutations might disrupt these interactions.

How can researchers identify binding sites for ubiquinone and potential inhibitors in MT-ND4L?

Identifying binding sites for ubiquinone and inhibitors in MT-ND4L can be accomplished through multiple complementary approaches:

  • Photoaffinity labeling: Use photoreactive analogs of ubiquinone or inhibitors to covalently tag binding sites, followed by mass spectrometric identification of labeled residues.

  • Site-directed mutagenesis: Systematically mutate potential binding site residues and assess the impact on substrate binding and catalytic activity.

  • Competition assays: Measure the ability of different compounds to compete with ubiquinone for binding to MT-ND4L.

  • Computational docking: Use in silico modeling to predict binding sites based on the protein structure.

  • Structure-activity relationship studies: Analyze how structural modifications to inhibitors affect their binding and inhibitory potency.

Studies on related enzymes like Na⁺-pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae have demonstrated that ubiquinone binding sites and inhibitor binding sites can be in close proximity without overlapping .

What are the most reliable assays for measuring the specific activity of recombinant MT-ND4L?

Several assays can reliably measure the activity of recombinant MT-ND4L:

  • Ubiquinone reduction assay: Measure the decrease in absorbance at 275 nm as ubiquinone is reduced to ubiquinol.

  • Dichlorophenolindophenol (DCPIP) reduction assay: Monitor the reduction of DCPIP at 600 nm as an indicator of electron transfer activity.

  • NADH oxidation assay: Track the oxidation of NADH by following the decrease in absorbance at 340 nm.

  • Complex I-specific activity measurements: Assess the sensitivity of NADH:ubiquinone oxidoreductase activity to specific Complex I inhibitors like rotenone.

  • Membrane potential measurements: Use voltage-sensitive dyes to monitor membrane potential changes associated with proton pumping activity.

For optimal results, these assays should be performed under varying conditions (pH, temperature, ionic strength) to determine the kinetic parameters and optimal conditions for the Episoriculus fumidus MT-ND4L .

How can researchers investigate the role of MT-ND4L in adaptive responses to environmental stresses?

To investigate MT-ND4L's role in adaptation to environmental stresses:

  • Comparative genomics: Analyze MT-ND4L sequences from species adapted to different environments (e.g., high-altitude vs. low-altitude habitats).

  • SNP association studies: Identify specific nucleotide polymorphisms associated with environmental adaptations.

  • Haplotype analysis: Determine if certain MT-ND4L haplotypes correlate with adaptive traits.

  • Physiological challenge experiments: Subject model organisms with different MT-ND4L variants to environmental stressors (hypoxia, cold, heat) and measure metabolic responses.

  • Gene editing: Use CRISPR/Cas9 or other editing techniques to introduce specific MT-ND4L variants into cell lines or model organisms.

Research on MT-ND4L in cattle has shown that certain SNPs and haplotypes have significant associations with high-altitude adaptation. For example, SNP m.10073C>T was positively associated with high-altitude adaptation (p<0.0006), while haplotype Ha1 in MT-ND4L showed positive associations with high-altitude adaptability .

How can studies of Episoriculus fumidus MT-ND4L contribute to our understanding of mitochondrial evolution and adaptation?

Studies of Episoriculus fumidus MT-ND4L can advance our understanding of mitochondrial evolution and adaptation in several ways:

  • Comparative analysis: Comparing the structure and function of MT-ND4L across species can reveal evolutionary pressures on mitochondrial genes.

  • Adaptation mechanisms: Identifying unique features of Episoriculus fumidus MT-ND4L may reveal adaptations to specific environmental conditions.

  • Molecular evolution rates: Analyzing mutation rates in MT-ND4L can provide insights into the molecular clock of mitochondrial evolution.

  • Functional conservation: Determining which domains are most conserved can highlight functionally critical regions.

  • Coevolution patterns: Studying how MT-ND4L has evolved in concert with other mitochondrial and nuclear genes can reveal coevolutionary relationships.

This research could particularly enhance our understanding of how mitochondrial proteins adapt to specific environmental niches, such as the habitat of Episoriculus fumidus in Taiwan, and how these adaptations affect mitochondrial function .

What emerging technologies might enhance future research on MT-ND4L function and structure?

Several emerging technologies show promise for advancing MT-ND4L research:

  • Cryo-electron tomography: Provides 3D visualization of MT-ND4L within intact mitochondria, revealing native conformational states.

  • AI-powered molecular dynamics: Enhances sampling of conformational space to identify functional states not captured by static structural methods .

  • Base editing technologies: Allow precise introduction of specific mitochondrial DNA mutations without double-strand breaks, enabling more refined genetic studies.

  • Single-molecule functional studies: Track the activity of individual Complex I molecules to reveal functional heterogeneity.

  • Nanoscale secondary ion mass spectrometry (NanoSIMS): Enables visualization of metabolic activities at subcellular resolution.

  • Advanced proteomics techniques: Identify post-translational modifications and protein-protein interactions involving MT-ND4L with unprecedented sensitivity.

  • Computational integration of multi-omics data: Combines genomics, proteomics, and metabolomics data to provide systems-level understanding of MT-ND4L function.

These technologies collectively offer pathways to more comprehensive characterization of MT-ND4L structure, function, and roles in health and disease .

What are common challenges in expressing and purifying functional recombinant MT-ND4L, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant MT-ND4L:

  • Low expression levels:

    • Challenge: As a hydrophobic membrane protein, MT-ND4L often expresses poorly in conventional systems.

    • Solution: Use specialized expression strains (C41/C43), lower induction temperatures (16-18°C), and optimize codon usage for the expression host.

  • Protein aggregation:

    • Challenge: MT-ND4L tends to aggregate when expressed outside its native complex.

    • Solution: Co-express with other Complex I subunits or use fusion partners like MBP or SUMO to enhance solubility.

  • Purification difficulties:

    • Challenge: Maintaining stability during purification.

    • Solution: Include appropriate detergents (DDM, LMNG, or digitonin) throughout the purification process, and avoid harsh elution conditions.

  • Loss of functionality:

    • Challenge: Recombinant protein may be structurally correct but functionally inactive.

    • Solution: Reconstitute into proteoliposomes with appropriate lipid composition to restore native-like membrane environment.

  • Verification of proper folding:

    • Challenge: Confirming correct protein folding.

    • Solution: Use circular dichroism spectroscopy and limited proteolysis assays to assess secondary structure and folding status .

How can researchers address contradictory results when studying MT-ND4L function across different experimental systems?

When faced with contradictory results across experimental systems, researchers should:

  • Standardize experimental conditions:

    • Use consistent buffer compositions, pH, temperature, and substrate concentrations across systems.

    • Document all experimental variables meticulously to identify potential sources of variation.

  • Validate antibody specificity:

    • Perform proper controls for antibody cross-reactivity, especially when comparing results across species.

    • Consider epitope accessibility differences in various experimental contexts.

  • Address heteroplasmy effects:

    • In cell-based or animal models, quantify the proportion of wild-type versus mutant mitochondrial DNA.

    • Correlate functional outcomes with the degree of heteroplasmy.

  • Consider tissue-specific effects:

    • Recognize that MT-ND4L mutations may manifest differently across tissue types due to varying energy demands.

    • Compare results from multiple tissue types or cell lines when possible.

  • Account for compensatory mechanisms:

    • Investigate potential adaptive responses that might mask primary defects in certain experimental systems.

    • Look for alternative metabolic pathways that might be upregulated.

  • Perform detailed comparative analysis:

    • Systematically compare methodologies, systems, and conditions used in contradictory studies.

    • Identify specific variables that correlate with divergent outcomes .

What interdisciplinary approaches might yield new insights into MT-ND4L function and its role in mitochondrial biology?

Productive interdisciplinary approaches for MT-ND4L research include:

  • Integrating structural biology with computational biology:

    • Combine cryo-EM structures with molecular dynamics simulations to model conformational changes during catalysis.

    • Use machine learning to predict functional impacts of MT-ND4L variants.

  • Merging evolutionary biology with biochemistry:

    • Compare MT-ND4L across species adapted to different environments to identify functionally important adaptations.

    • Correlate sequence variations with biochemical properties and environmental factors.

  • Combining clinical research with basic science:

    • Analyze MT-ND4L variants in patients with mitochondrial disorders to identify structure-function relationships.

    • Test identified variants in model systems to establish causality.

  • Integrating systems biology with bioenergetics:

    • Create metabolic flux models incorporating MT-ND4L function.

    • Measure effects of MT-ND4L variants on global cellular metabolism.

  • Applying synthetic biology approaches:

    • Design minimal mitochondrial respiratory chains to test fundamental principles of MT-ND4L function.

    • Engineer MT-ND4L variants with enhanced properties for biotechnological applications .

How can researchers studying MT-ND4L in Episoriculus fumidus collaborate with those studying the protein in other species to advance mitochondrial research?

Effective collaboration strategies include:

  • Establish a centralized database:

    • Create a repository of MT-ND4L sequences, structures, and functional data across species.

    • Standardize data formats and experimental protocols to facilitate comparisons.

  • Develop shared resources:

    • Generate and distribute validated antibodies, expression constructs, and cell lines.

    • Create a biobank of tissue samples from various species.

  • Implement coordinated research initiatives:

    • Design parallel studies using identical methodologies across species.

    • Perform systematic comparative analyses to identify conserved and species-specific features.

  • Form interdisciplinary research networks:

    • Connect researchers with complementary expertise (e.g., structural biologists, geneticists, physiologists).

    • Organize regular symposia or workshops focused on mitochondrial complex I biology.

  • Utilize phylogenetic approaches:

    • Map functional differences to evolutionary divergence events.

    • Identify natural experiments in MT-ND4L evolution that provide insights into structure-function relationships.

This collaborative framework could rapidly advance understanding of MT-ND4L function while minimizing redundant efforts and maximizing the translational potential of findings across species .

What resources are available for researchers new to studying mitochondrial proteins like MT-ND4L?

Researchers entering the field of mitochondrial protein research can utilize:

  • Database resources:

  • Methodological guides:

    • Mitochondrial research protocols collections (Springer Protocols, Methods in Molecular Biology series).

    • Online courses in mitochondrial biology through platforms like Coursera or edX.

  • Research communities:

    • United Mitochondrial Disease Foundation (UMDF) for connecting with clinicians and researchers.

    • International Mito Patients organization for patient-centered research priorities.

  • Specialized software:

    • MitoTools (http://www.mitotools.org/): Software suite for analyzing mitochondrial DNA sequences.

    • MEGA (Molecular Evolutionary Genetics Analysis): For evolutionary analyses of mitochondrial proteins.

  • Repositories of recombinant proteins:

    • Addgene for plasmids and expression vectors.

    • Commercial sources of purified mitochondrial proteins for reference standards .

How can established researchers mentor newcomers to the field of mitochondrial complex I research?

Effective mentorship approaches include:

  • Structured training programs:

    • Develop laboratory rotations covering key techniques in mitochondrial research.

    • Create step-by-step protocols specific to MT-ND4L and Complex I analysis.

  • Collaborative project design:

    • Pair newcomers with experienced researchers on well-defined projects.

    • Gradually increase project complexity and independence.

  • Critical literature analysis:

    • Organize journal clubs focused on landmark papers in Complex I research.

    • Guide discussion of methodological strengths and limitations.

  • Technical skill development:

    • Provide hands-on training in specialized techniques (e.g., mitochondrial isolation, blue native PAGE).

    • Develop troubleshooting guides for common experimental challenges.

  • Career development support:

    • Assist in identifying funding opportunities specific to mitochondrial research.

    • Connect mentees with collaborators and potential employers in the field.

  • Cross-disciplinary exposure:

    • Encourage attendance at conferences spanning basic science to clinical applications.

    • Facilitate internships in complementary research environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.