Recombinant Episoriculus fumidus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Biological Overview of MT-ND6

MT-ND6 is a hydrophobic transmembrane protein (18 kDa, 172–178 amino acids) integral to Complex I, the largest enzyme in the mitochondrial electron transport chain. It is one of seven mitochondrial-encoded subunits (MT-ND1 to MT-ND6 and MT-ND4L) that form the core of Complex I’s membrane domain .

Key Features:

PropertyDescription
Gene LocationMitochondrial DNA (L-strand), positions 14,149–14,673 (human homolog)
Protein Length178 amino acids (recombinant variant)
FunctionFacilitates electron transfer from NADH to ubiquinone, proton pumping
Pathological AssociationsLeber’s hereditary optic neuropathy (LHON), Leigh syndrome, dystonia

2.2. Complex I Interactions

MT-ND6 interacts with nuclear-encoded subunits such as NDUFS3 and ATP-dependent metalloprotease YME1L1, stabilizing Complex I assembly . Mutations in MT-ND6 disrupt ubiquinone binding and electron transfer efficiency, increasing reactive oxygen species (ROS) production .

3.1. Disease-Associated Mutations

MutationAmino Acid ChangeDisorderMechanism
T14484C (human)Met64ValLHONImpairs ubiquinone interaction, reduces ATP synthesis
G14459A (human)Ala72ValLeigh syndrome, dystoniaDisrupts Complex I assembly, increases ROS

Note: These mutations are observed in human MT-ND6 and highlight the protein’s conserved functional regions across species.

3.2. Functional Consequences

Mutations in MT-ND6 reduce Complex I activity by 50–90%, leading to:

  • Energy Deficits: Impaired ATP production in high-energy-demand tissues (e.g., optic nerve, brain) .

  • Oxidative Stress: Elevated ROS levels due to electron leak, contributing to cellular damage .

4.2. Experimental Uses

ApplicationDetails
Structural StudiesX-ray crystallography or cryo-EM to resolve Complex I interactions
Enzyme AssaysNADH-ubiquinone oxidoreductase activity measurement
Disease ModelingScreening MT-ND6 mutations in LHON or Leigh syndrome

Comparative Analysis with Other MT-ND6 Variants

SpeciesSourcePurityTagApplication
Episoriculus fumidusE. coli>90%HisStructural studies, disease modeling
Balaenoptera musculusCell-free>85%NoneEvolutionary comparisons
Metridium senileCell-free>85%NoneMarine organism studies

Challenges and Future Directions

  1. Production Limitations: Low yields in E. coli due to hydrophobicity; alternative systems (e.g., yeast, mammalian cells) are under investigation .

  2. Functional Validation: Need for standardized assays to confirm recombinant MT-ND6’s activity in Complex I reconstitution .

  3. Therapeutic Targets: Mutagenesis studies to identify residues critical for ubiquinone binding and ROS mitigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Episoriculus fumidus (Taiwan brown-toothed shrew) (Soriculus fumidus)
Target Names
Target Protein Sequence
MMTYIVTILSTIFVVSFVGFSSKPSPIYGGVGLIVSGGVGCGIVLNYGGSFLGLMVFLIY LGGMLVVFGYTTAMAMEEYPEVWVSNNTVLLTFLLGLVGEVVLMIYLLLGEEEVKFEVVL NFNSEGDWVIYDTGDSGMFSEEAMGVAALYSYGYWLVIVSGWSLVTCIIVVMEITRGN
Uniprot No.

Target Background

Function

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND6 and what is its functional role in mitochondrial biology?

MT-ND6 (mitochondrially encoded NADH dehydrogenase subunit 6) is an essential component of the mitochondrial respiratory complex I (NADH:ubiquinone oxidoreductase), which catalyzes the first step in the electron transport chain of oxidative phosphorylation. This protein plays a critical role in cellular energy production by facilitating electron transfer from NADH to ubiquinone, contributing to the generation of the proton gradient necessary for ATP synthesis . In Episoriculus fumidus (Taiwan brown-toothed shrew), MT-ND6 consists of 178 amino acids and is encoded by the mitochondrial genome . Studies in various mammalian species have shown that variations in this gene can significantly impact metabolic efficiency and adaptation to different environmental conditions .

What expression systems are available for producing recombinant MT-ND6?

Several expression systems have been validated for the production of recombinant Episoriculus fumidus MT-ND6:

Expression SystemAdvantagesConsiderationsProduct Code Example
E. coliHigh yield, cost-effective, rapid productionMay require refolding for optimal activityCSB-EP836059EDAR1
YeastPost-translational modifications, proper foldingLonger production timeCSB-YP836059EDAR1
BaculovirusEukaryotic processing, high expressionMore complex production protocolCSB-BP836059EDAR1
Mammalian cellsNative-like modifications, proper foldingLower yield, higher costCSB-MP836059EDAR1

Selection of the appropriate expression system should be based on the specific research requirements, particularly considering whether post-translational modifications are critical for the intended experimental applications .

What are the optimal storage and handling conditions for recombinant MT-ND6?

For optimal stability and activity retention of recombinant MT-ND6, the following storage and handling protocols are recommended:

  • Long-term storage: Store lyophilized protein at -20°C/-80°C upon receipt

  • Working solutions: Store aliquots at 4°C for up to one week

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (recommended: 50%)

    • Aliquot for long-term storage at -20°C/-80°C

  • Stability considerations: Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

Proper aliquoting upon initial reconstitution is crucial for maintaining protein integrity over extended research periods .

How can researchers assess positive selection in MT-ND6 sequences?

Multiple complementary approaches are recommended for robust detection of positive selection in MT-ND6 sequences:

  • Maximum likelihood and Bayesian approaches: Compare the ratio of nonsynonymous to synonymous substitutions (dN/dS) using models implemented in PAML :

    • Compare nested models (M0 vs. M3, M1a vs. M2a, M7 vs. M8)

    • Apply likelihood ratio tests (LRT) to determine statistical significance

    • 2× log likelihood differences should be compared to χ² distribution

  • Web-based selection analysis:

    • Employ the Datamonkey Adaptive Evolution server for complementary analysis

    • Apply Single Likelihood Ancestral Counting (SLAC) methods for codon-specific selection

  • Population genetics approaches:

    • Calculate molecular diversity indices using DnaSP

    • Perform neutrality tests (Tajima's D, Fu and Li's tests)

    • Analyze mismatch distribution patterns using ARLEQUIN 3.5.1.2

In a comprehensive study of brown hares, these methods consistently identified one specific codon position under positive selection that occurred exclusively in European populations, giving rise to protein variants primarily in the southeastern and south-central Balkans .

What methodologies are optimal for analyzing phylogeographic patterns of MT-ND6?

For robust phylogeographic analysis of MT-ND6 sequences, researchers should implement a multi-faceted approach:

  • Sequence diversity assessment:

    • Calculate haplotype diversity, nucleotide diversity, and average number of nucleotide differences

    • Use DnaSP for initial assessment of molecular polymorphism

  • Network analysis:

    • Construct median-joining networks to visualize relationships among haplotypes

    • Evaluate reticulations that may indicate homoplasy or recombination events

  • Spatial clustering:

    • Implement Geneland 3.0 using an uncorrelated model based on multinomial distribution

    • Run multiple iterations (recommended: 1,000,000) with sampling every 100 steps

    • Discard first 30% as burn-in to ensure chain convergence

  • Coalescent-based modeling:

    • Apply Bayesian Phylogeographic and Ecological Clustering (BPEC)

    • Account for haplotype connection ambiguities

    • Run MCMC chains for ≥20 million iterations with sampling every 1000 steps

    • Apply strict parsimony criterion with defined maximum number of migrations

  • Population differentiation analysis:

    • Calculate ΦST pairwise differences between identified clusters

    • Perform Analysis of Molecular Variance (AMOVA) using ARLEQUIN

This integrated approach successfully revealed that MT-ND6 phylogeographic patterns in brown hares followed models based on neutrally evolving D-loop sequences, reflecting Late Pleistocene demographic scenarios .

How do environmental factors influence MT-ND6 evolution and adaptation?

Research on brown hares (Lepus europaeus) provides valuable insights into environmental influences on MT-ND6 evolution:

  • Climate correlation analysis:

    • Multinomial regression models can test relationships between climate parameters and protein variants

    • Statistical software (e.g., SPSS) should be used to ensure robust statistical inference

  • Precipitation effects:

    • Significant correlations have been found between precipitation patterns and specific MT-ND6 variants

    • In brown hares, variants from southeastern and south-central Balkans showed precipitation-dependent distribution

  • Topographic considerations:

    • Altitudinal variation may impose novel selective pressures on protein variants

    • The Balkans case study demonstrated that regions with greater topographic complexity exhibited higher MT-ND6 diversity

  • Adaptive significance:

    • MT-ND6 variants may affect cellular energy production efficiency under different environmental conditions

    • Selection pressures likely relate to regional adaptation to specific climatic regimes

Research suggests that positive selection on MT-ND6 is driven by adaptation to local environmental conditions, particularly precipitation patterns, which may influence oxidative phosphorylation efficiency in different habitats .

What functional assays can be used to characterize MT-ND6 variants?

To evaluate the functional implications of MT-ND6 variants, researchers should consider these methodological approaches:

  • Complex I activity assays:

    • Measure NADH:ubiquinone oxidoreductase activity in isolated mitochondria

    • Compare enzyme kinetics parameters (Km, Vmax) across variants

    • Assess activity under different temperature and pH conditions to identify condition-dependent performance differences

  • Oxygen consumption measurements:

    • Employ high-resolution respirometry to measure oxygen consumption rates

    • Compare respiratory control ratios across variants

    • Evaluate the impact of variants on coupling efficiency

  • ROS production assessment:

    • Measure reactive oxygen species generation using fluorescent probes

    • Compare ROS production rates across variants under different substrate conditions

    • Assess potential trade-offs between energy production efficiency and oxidative stress

  • Structure-function analysis:

    • Use recombinant protein with site-directed mutagenesis to introduce specific variants

    • Apply circular dichroism spectroscopy to assess structural changes

    • Perform thermal stability assays to determine if variants alter protein stability

  • In vivo energetics:

    • Develop cellular models expressing different variants

    • Measure ATP production rates under various environmental stressors

    • Assess cellular survival and proliferation under challenging conditions

These functional approaches can establish mechanistic links between genetic variation and adaptive significance in different environmental contexts.

What are the critical quality control parameters for recombinant MT-ND6?

Ensuring high-quality recombinant MT-ND6 requires rigorous quality control:

Quality ParameterRecommended MethodAcceptance Criteria
PuritySDS-PAGE>90% purity
IdentityMass spectrometryMatches theoretical mass
Tag verificationWestern blotDetectable tag signal
Endotoxin levelsLAL assay<0.1 EU/μg protein
ActivityNADH oxidation assaySubstrate-dependent activity
StabilityAccelerated stability testing<10% activity loss over defined period

For research applications requiring particularly stringent quality control, additional parameters such as circular dichroism spectroscopy to verify secondary structure and size exclusion chromatography to confirm absence of aggregation are recommended .

How should researchers design primers for MT-ND6 sequencing studies?

Based on successful sequencing approaches in previous studies, the following primer design guidelines are recommended:

  • Primer positioning:

    • Design primers in conserved regions flanking the MT-ND6 gene

    • In brown hare studies, the following primers were effective:

      • Forward: 5'-CAATACACCGCCTCTTACCT-3'

      • Reverse: 5'-GGTGCGTTTTACGAATGTTG-3'

  • PCR optimization:

    • Use 100 ng genomic DNA in 25 μl reaction volume

    • Include 0.2 mM dNTP, 0.2 μM of each primer

    • Employ high-fidelity DNA polymerase for accurate sequence determination

    • Recommended thermal cycling: 95°C (4 min), followed by 30 cycles of 95°C (60s), 54°C (45s), 72°C (45s), with final extension at 72°C (5 min)

  • Sequence verification:

    • Purify PCR products using Exo-SAP protocol

    • Sequence using BigDye Terminator Cycle Sequencing kit or equivalent

    • Analyze on automated DNA sequencer (e.g., ABI 3130xl)

    • Align sequences using Clustal algorithm with manual adjustment

  • Outgroup selection:

    • Include appropriate outgroup sequences for phylogenetic analysis

    • For mammalian studies, consider congeneric species or closely related genera

These approaches have successfully generated high-quality MT-ND6 sequence data across multiple species, enabling robust phylogenetic and selection analyses .

What bioinformatic workflow is recommended for comprehensive MT-ND6 analysis?

For thorough analysis of MT-ND6 sequence data, the following bioinformatic workflow is recommended:

  • Initial sequence processing:

    • Quality assessment and trimming of raw sequences

    • Multiple sequence alignment with Clustal or MUSCLE

    • Manual adjustment to ensure proper codon alignment

  • Diversity and population structure analysis:

    • Calculate molecular diversity indices (haplotype diversity, nucleotide diversity)

    • Construct haplotype networks using Network software

    • Apply Bayesian clustering methods (Geneland, BPEC) for spatial analysis

  • Selection analysis pipeline:

    • Implement site-specific selection models in PAML (codeml)

    • Compare nested models using likelihood ratio tests

    • Apply complementary methods via Datamonkey Adaptive Evolution server

    • Perform sliding window analysis of dN/dS ratios

  • Environmental correlation:

    • Extract climate data for sampling locations

    • Develop multinomial regression models

    • Test associations between variants and environmental variables

    • Apply appropriate corrections for multiple testing

  • Visualization and interpretation:

    • Generate phylogenetic trees with appropriate support values

    • Map spatial distribution of variants using GIS approaches

    • Create graphical representations of selection patterns

    • Develop models linking genetic variation to functional adaptation

This integrated bioinformatic approach has successfully identified adaptive patterns in MT-ND6 across multiple mammalian species .

How can recombinant MT-ND6 be utilized in complex I assembly studies?

Recombinant MT-ND6 provides valuable tools for investigating complex I assembly:

  • In vitro reconstitution experiments:

    • Combine recombinant MT-ND6 with other complex I subunits

    • Monitor assembly intermediates using blue native electrophoresis

    • Identify critical interaction partners using pull-down assays

  • Protein-protein interaction mapping:

    • Utilize tagged recombinant MT-ND6 (His-tagged, Avi-tag Biotinylated)

    • Perform crosslinking mass spectrometry to identify interaction interfaces

    • Validate interactions using surface plasmon resonance or isothermal titration calorimetry

  • Assembly kinetics analysis:

    • Introduce labeled recombinant MT-ND6 into mitochondrial preparations

    • Track incorporation using time-course immunoprecipitation

    • Identify rate-limiting steps in complex I biogenesis

  • Comparative analysis across species:

    • Assess interchangeability of MT-ND6 from different species in reconstitution experiments

    • Evaluate whether adaptive variants alter assembly efficiency or stability

    • Determine if environmental adaptations affect complex I assembly parameters

These approaches can provide insights into both fundamental aspects of mitochondrial biology and mechanisms of evolutionary adaptation in complex I assembly.

What are the emerging research directions for MT-ND6 in evolutionary biology?

Several promising research avenues are emerging for MT-ND6 in evolutionary biology:

  • Expanded phylogenetic sampling:

    • Extend current studies to diverse taxa across varied environments

    • Compare selection patterns across evolutionary lineages

    • Identify convergent evolution in response to similar environmental pressures

  • Integration with whole-genome approaches:

    • Combine MT-ND6 data with nuclear genome analysis

    • Identify co-evolutionary patterns between mitochondrial and nuclear genes

    • Develop models of mitonuclear compatibility in adaptive evolution

  • Experimental evolution studies:

    • Subject model organisms to controlled environmental pressures

    • Track MT-ND6 sequence changes over generations

    • Validate adaptive hypotheses through directed evolution approaches

  • Climate change adaptation research:

    • Monitor MT-ND6 variation in populations experiencing rapid climate change

    • Develop predictive models for genetic adaptation to changing environments

    • Assess potential limits to adaptive capacity in energy metabolism genes

  • Functional validation of adaptive hypotheses:

    • Introduce specific variants into model organisms using CRISPR-based approaches

    • Measure fitness parameters under controlled environmental conditions

    • Test whether precipitation-associated variants confer advantages under specific moisture regimes

The established correlation between MT-ND6 variants and precipitation patterns in brown hares provides a compelling foundation for these future research directions .

What are common challenges in recombinant MT-ND6 expression and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant MT-ND6:

ChallengePotential CausesRecommended Solutions
Low expression yieldProtein toxicity to host cells, suboptimal codon usageUse inducible expression systems, optimize codons for expression host, reduce induction temperature
Inclusion body formationHydrophobic transmembrane domains, improper foldingExpress as fusion protein with solubility tags, optimize refolding protocols, use specialized E. coli strains
Protein aggregationImproper storage, buffer incompatibilityInclude 5-50% glycerol in storage buffer, store at appropriate temperature, optimize buffer composition
Loss of activityDenaturation during purification, improper reconstitutionUse mild detergents, avoid harsh elution conditions, follow recommended reconstitution protocols
Tag interference with functionSteric hindrance at functional sitesConsider tag placement (N vs. C terminal), include cleavable tags, validate activity with and without tag

For particularly challenging expression scenarios, consider alternative expression systems such as cell-free protein synthesis or specialized membrane protein expression hosts .

How can researchers optimize PCR amplification of MT-ND6 from diverse species?

When amplifying MT-ND6 from new or diverse species, consider these optimization strategies:

  • Primer design refinement:

    • Align MT-ND6 sequences from related species to identify conserved regions

    • Design degenerate primers to accommodate potential sequence variations

    • Consider nested PCR approaches for difficult templates

  • DNA quality improvement:

    • Use specialized extraction protocols for degraded samples

    • Assess DNA quality using spectrophotometric and gel electrophoresis methods

    • Implement DNA purification steps to remove PCR inhibitors

  • PCR condition optimization:

    • Test gradient PCR to identify optimal annealing temperatures

    • Adjust magnesium concentration in 0.5 mM increments

    • Evaluate different DNA polymerases (standard, high-fidelity, hot-start)

    • Consider additives like DMSO, betaine, or BSA for difficult templates

  • Amplification protocol modifications:

    • Implement touchdown PCR to increase specificity

    • Adjust cycle numbers based on starting template concentration

    • For GC-rich regions, include specialized buffers or co-solvents

  • Validation approaches:

    • Confirm amplicon identity by restriction digestion

    • Sequence both strands to ensure accurate determination

    • Compare with reference sequences to validate authenticity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.