Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Epstein-Barr Virus Apoptosis Regulator BHRF1

Recombinant Epstein-Barr virus Apoptosis regulator BHRF1, commonly referred to as BHRF1, is a viral protein encoded by the Epstein-Barr virus (EBV). It is homologous to the mammalian Bcl-2 family of proteins, which play crucial roles in regulating apoptosis, or programmed cell death. BHRF1 is known for its anti-apoptotic properties, which contribute to the survival and proliferation of EBV-infected cells, particularly in the context of lymphomagenesis and other EBV-associated malignancies.

Structure and Function of BHRF1

BHRF1 functions by binding to and inhibiting pro-apoptotic members of the Bcl-2 family, such as Bim, Puma, Bid, and Bak . This interaction prevents the activation of downstream apoptotic pathways, thereby promoting cell survival. The structural basis of BHRF1's anti-apoptotic activity involves its BH3-binding groove, which is essential for binding to pro-apoptotic proteins .

Key Features of BHRF1:

  • Anti-apoptotic activity: Inhibits apoptosis by binding to pro-apoptotic proteins.

  • Structural homology: Similar to mammalian Bcl-2 proteins.

  • Role in EBV-associated diseases: Contributes to lymphomagenesis and chemoresistance.

Role in EBV-Associated Diseases

BHRF1 is implicated in the development and maintenance of certain EBV-associated lymphomas, such as Burkitt lymphoma. It confers chemoresistance and impacts survival in mouse models of Burkitt lymphoma by sequestering pro-apoptotic proteins . Additionally, BHRF1 plays a role in post-transplant lymphoproliferative disease by promoting the survival of lymphoblastoid cells .

BHRF1 in EBV-Associated Lymphomas:

DiseaseRole of BHRF1
Burkitt LymphomaContributes to chemoresistance and impacts survival
Post-transplant Lymphoproliferative DiseasePromotes lymphoblastoid cell survival

Research Findings and Implications

Recent studies have highlighted the potential of BHRF1 as a therapeutic target for treating EBV-associated malignancies. By inhibiting BHRF1, it may be possible to enhance the efficacy of chemotherapy and improve patient outcomes . The development of small molecule inhibitors targeting BHRF1 is an area of active research, with the goal of selectively antagonizing BHRF1 without affecting normal cells .

Therapeutic Potential of BHRF1 Inhibition:

  • Targeted therapy: Inhibiting BHRF1 could enhance chemotherapy efficacy.

  • Selective antagonism: Potential to spare normal cells while targeting EBV-infected cells.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BHRF1Apoptosis regulator BHRF1; Early antigen protein R; EA-R; Nuclear antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Target Names
BHRF1
Target Protein Sequence
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI CSYLFISRGRH
Uniprot No.

Target Background

Function

Function: Prevents premature host cell death during viral production, thus maximizing viral yield. BHRF1 acts as a Bcl-2 homolog, interacting with pro-apoptotic proteins to inhibit mitochondrial permeabilization, cytochrome c release, and subsequent apoptosis of the host cell.

Database Links

KEGG: vg:3783706

Protein Families
Bcl-2 family
Subcellular Location
Host membrane; Single-pass membrane protein. Host mitochondrion. Note=also observed in the perinuclear region of the cell.

Q&A

What is the structural relationship between BHRF1 and mammalian Bcl-2 family proteins?

BHRF1 is a viral homolog of mammalian pro-survival protein Bcl-2, despite having limited sequence conservation. BHRF1 adopts the conserved alpha-helical Bcl-2 fold comprising eight α-helices, with helices α2–α5 forming the canonical hydrophobic ligand-binding groove that provides the interaction site for BH3-motif peptides . Sequence identity between BHRF1 and human pro-survival proteins varies considerably:

Human Pro-survival ProteinSequence Identity with BHRF1
Bcl-221.7%
Bcl-xL17.9%
Bcl-w18.4%
Mcl-19.6%
Bfl-1/A117.8%
Bcl-B21.5%

Despite this relatively low sequence homology, BHRF1 exhibits remarkable functional similarity to mammalian Bcl-2. Confocal microscopic analysis of cells acutely cotransfected with BHRF1 and Bcl-2 expression vectors revealed substantial colocalization of the two proteins in the cytoplasm, indicating shared subcellular distribution patterns . This structural and functional homology provides the mechanistic basis for BHRF1's ability to protect B cells from apoptosis.

Which pro-apoptotic proteins does BHRF1 interact with, and how are these interactions characterized?

BHRF1 selectively interacts with a subset of pro-apoptotic Bcl-2 family members. Isothermal titration calorimetry (ITC) experiments with recombinant C-terminally truncated BHRF1 demonstrate direct binding to peptides spanning the BH3 domains of specific pro-apoptotic proteins with the following binding affinities:

  • Bim: KD = 18 nM

  • Puma: KD = 70 nM

  • Bid: KD = 110 nM

No detectable binding was observed with peptides from other BH3-only proteins or with Mule and Beclin-1, which also harbor BH3 domains . Co-immunoprecipitation assays confirm these interactions in mammalian cells with full-length proteins . Notably, BHRF1 can directly bind and inhibit Bak but must inhibit Bax indirectly, presumably through sequestration of BH3-only proteins such as Bim . These selective binding characteristics help explain BHRF1's efficient anti-apoptotic activity in EBV-infected cells.

What experimental approaches have been used to express and purify recombinant BHRF1?

While the provided search results don't directly describe expression and purification protocols for recombinant BHRF1, the crystallographic studies indicate successful approaches. For structural studies, researchers typically use bacterial expression systems with His-tag or GST-tag fusion constructs of BHRF1 with the C-terminal transmembrane domain truncated (often residues 1-160). Purification generally follows standard protocols involving affinity chromatography, tag cleavage, and size exclusion chromatography.

For functional studies in mammalian cells, stable expression of BHRF1 has been achieved in various cell lines, including FDC-P1 mouse myelomonocytic cells, using standard transfection techniques . When designing expression constructs, researchers should consider that BHRF1 is typically active as a monomeric protein, and the C-terminal transmembrane domain may affect solubility but is not essential for in vitro binding studies with BH3 peptides.

How does BHRF1 function in the context of the EBV lifecycle?

BHRF1 plays multiple roles in the EBV lifecycle, particularly in enhancing B-cell survival during both latent and lytic infection phases. During latent infection, BHRF1 may complement the action of other viral genes to promote long-term survival of infected B cells. In the lytic cycle, BHRF1 provides an alternative, Bcl-2-independent means of enhancing B-cell survival .

Recent studies link BHRF1 to the transformation of primary B lymphocytes and to lymphomagenesis . BHRF1 expression permits lymphoblastoid immortalization by EBV and their prolonged survival, suggesting a role in post-transplant lymphoproliferative disease . BHRF1 may be especially critical in Burkitt lymphoma, where it potentially blocks myc-induced apoptosis, mirroring the synergy observed between Bcl-2 and myc during B cell transformation . This highlights BHRF1's importance not only in the viral lifecycle but also in EBV-associated malignancies.

What structural data are available for BHRF1 complexes, and how can these inform drug design efforts?

Several crystal structures of BHRF1 in complex with pro-apoptotic BH3 domains have been determined and deposited in the Protein Data Bank. Two key structures include:

ComplexPDB IDResolutionSpace GroupCell Dimensions
BHRF1–BidBH37P332.78 ÅP6522a,b,c = 94.20, 94.20, 455.58 Å; α,β,γ = 90°, 90°, 120°
BHRF1–PumaBH37P9W2.00 ÅP3221a,b,c = 62.77, 62.77, 92.60 Å; α,β,γ = 90°, 90°, 120°

Additional structures include BHRF1 in complex with Bim and Bak BH3 domains . These structures reveal the molecular details of how BHRF1 engages its pro-apoptotic targets and highlight both similarities and differences compared to mammalian Bcl-2 proteins.

These structural data are particularly valuable because current small molecule antagonists of Bcl-2 do not effectively target BHRF1 . The available structures can guide structure-based drug design efforts to develop selective BHRF1 inhibitors. Special attention should be paid to the hydrophobic groove formed by helices α2–α5, which provides the interaction site for BH3 peptides . Researchers developing BHRF1 inhibitors should also consider the F72W BHRF1 mutant that selectively binds Puma with altered specificity .

What is the precise mechanism by which BHRF1 inhibits apoptosis in infected cells?

BHRF1 inhibits apoptosis by preserving mitochondrial function through preventing the activation of the pro-apoptotic effectors Bax and Bak. Specifically, BHRF1:

  • Inhibits mitochondrial outer membrane permeabilization (MOMP) as demonstrated by preserved uptake of the mitochondrial dye DiOC6(3) in BHRF1-expressing cells after apoptotic stimuli .

  • Prevents Bax translocation from the cytosol to mitochondria during apoptotic signaling .

  • Blocks the conformational changes in Bax and Bak associated with their activation .

  • Inhibits cytochrome c release from mitochondria, a critical step in the intrinsic apoptotic pathway .

BHRF1 achieves these effects by direct sequestration of specific pro-apoptotic BH3-only proteins (Bim, Puma, Bid) that would otherwise activate Bax and Bak . Additionally, BHRF1 can directly bind and inhibit Bak (but not Bax) . This dual mechanism allows BHRF1 to efficiently block apoptosis initiated through multiple pathways, making it a powerful viral tool for extending the survival of infected cells.

How does BHRF1 contribute to chemoresistance in EBV-associated malignancies?

BHRF1 expression confers marked resistance to a wide range of cytotoxic agents used in cancer chemotherapy. Experimental evidence demonstrates that stable expression of BHRF1 in FDC-P1 mouse myelomonocytic cells provides resistance comparable to that of mammalian pro-survival proteins (Bcl-2, Bcl-xL, Bcl-w) against:

  • Etoposide

  • γ-irradiation

  • Cytosine arabinoside (Ara-C)

  • Doxorubicin

  • Staurosporine

This broad chemoresistance has significant implications for treating EBV-associated malignancies. In a mouse model of Burkitt lymphoma, BHRF1 expression rendered the tumor essentially untreatable . The potent anti-apoptotic function of BHRF1 effectively neutralizes the pro-apoptotic signals generated by various chemotherapeutic agents, primarily by preventing the activation of Bax and Bak as described in question 2.2.

The clinical significance is substantial, as EBV-associated malignancies expressing BHRF1 are likely to respond poorly to conventional chemotherapy regimens. This highlights the importance of developing specific BHRF1 inhibitors that could potentially restore chemosensitivity in these otherwise treatment-resistant tumors.

What approaches can be used to selectively target BHRF1 in therapeutic applications?

Current Bcl-2 family inhibitors do not effectively target BHRF1, creating a need for selective BHRF1 antagonists . Several approaches could be pursued:

  • Structure-based design of small molecules that specifically bind the hydrophobic groove of BHRF1, using the available crystal structures (7P33, 7P9W, and others) as templates. These inhibitors should exploit unique features of the BHRF1 binding groove that differ from mammalian anti-apoptotic proteins.

  • Development of stabilized alpha-helical peptides derived from the BH3 domains of Bim, Puma, or Bid that show high affinity for BHRF1 (with KD values of 18-110 nM) . These could be engineered with non-natural amino acids or hydrocarbon stapling to enhance stability and cell penetration.

  • Immunotherapeutic approaches targeting cells expressing BHRF1, potentially using antibody-drug conjugates or CAR-T cells.

  • RNA interference or antisense oligonucleotides to specifically downregulate BHRF1 expression in infected cells.

  • Allosteric inhibitors that bind to regions outside the BH3-binding groove, potentially disrupting BHRF1's interaction with other proteins or altering its conformation.

Developing BHRF1-specific inhibitors could provide a therapeutic strategy with potentially fewer side effects than general Bcl-2 family inhibitors, as normal cells do not express BHRF1 .

What are the technical considerations when performing binding assays with BHRF1 and BH3-only proteins?

When investigating BHRF1 interactions with pro-apoptotic proteins, researchers should consider several technical aspects:

  • Protein Preparation: For recombinant BHRF1, C-terminal truncation (typically residues 1-160) improves solubility by removing the transmembrane domain. Consider both tagged and untagged versions, as tags may interfere with some binding assays.

  • BH3 Peptides vs. Full-length Proteins: Both approaches have merit. Synthetic BH3 peptides (typically 26-amino acids) provide clean binding data but may not fully recapitulate interactions with full-length proteins. Full-length proteins better represent physiological interactions but may have solubility or expression challenges.

  • Binding Assay Selection:

    • Isothermal Titration Calorimetry (ITC): Provides direct measurement of binding affinities and thermodynamic parameters, as used to determine KD values for BHRF1-BH3 peptide interactions .

    • Fluorescence Polarization (FP): Useful for high-throughput screening of inhibitors.

    • Surface Plasmon Resonance (SPR): Provides kinetic information on association and dissociation rates.

    • Co-immunoprecipitation: Confirms interactions in cellular contexts .

  • Controls: Include both positive controls (known binding partners like Bim-BH3) and negative controls (BH3 domains known not to interact with BHRF1, such as those from other BH3-only proteins) .

  • Mutation Analysis: Consider testing BHRF1 mutants (e.g., F72W) that show altered binding specificity to understand the structural basis of interactions .

  • Cellular Assays: Complement in vitro binding studies with functional assays in relevant cell types, such as measuring apoptotic responses to various stimuli in the presence of wild-type or mutant BHRF1.

Careful consideration of these technical aspects will enhance the reliability and relevance of BHRF1 binding studies, whether for basic research or drug development applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.