Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LMP1; BNLF1; Latent membrane protein 1; LMP-1; Protein p63
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
Full Length of Mature Protein
Species
Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
Target Names
Target Protein Sequence
MERDLERGPPGPPRPPLGPPLSSSIGLALLLLLLALLFWLYIVLSNWTGGALLVLYSFALM LIIIILIIFIFRRDLLCPLGGLGLLLLMVTLLLIALWNLHGQALYLGIVLFIFGCLLVLG LWIYFLEILWRLGATIWQLLAFILAFFLAIILLIIALYLQQNWWTLLVDLLWLLLFMAIL IWMYFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQN LGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPS DSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQ LSYYD
Uniprot No.

Target Background

Function
Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1) functions as a CD40 functional homolog, preventing apoptosis of infected B-lymphocytes and driving their proliferation. It acts as a constitutively active tumor necrosis factor receptor, inducing the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling upregulates antiapoptotic proteins and provides growth signals in latently infected cells. It interacts with host UBE2I, subsequently affecting the sumoylation state of several cellular proteins. For example, it induces the sumoylation of host IRF7, limiting its transcriptional activity and modulating the activation of innate immune responses.
Protein Families
Herpesviridae LMP-1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of LMP1 in EBV-mediated B-cell transformation?

LMP1 serves as a key effector of EBV-mediated effects on cell growth and is essential for the conversion of resting human B lymphocytes into lymphoblastoid cell lines (LCLs). Genetic analyses with EBV recombinants have established that LMP1 can induce most phenotypic changes associated with EBV transformation of resting B lymphocytes, including:

  • Induction of adhesion molecule expression

  • Activation of NF-κB

  • Up-regulation of Bcl-2

  • Activation of stress-activated protein kinase

Beyond B-cell transformation, LMP1 can transform immortalized rodent fibroblast cell lines, resulting in loss of contact inhibition, lower serum dependence, anchorage independence, and tumorigenicity in nude mice .

What are the key structural domains of recombinant LMP1?

LMP1 consists of three distinct structural domains, each with specific functions:

  • N-terminal cytoplasmic domain (amino acids 1-24): While present, this domain is not a critical mediator of transformation based on recombinant EBV genetic analyses.

  • Transmembrane domain region (amino acids 25-186): Comprises six hydrophobic membrane-spanning domains separated by peptide turns. These domains enable LMP1 to aggregate in the plasma membrane, which is essential for its transforming activity.

  • C-terminal cytoplasmic domain (amino acids 187-386): Contains critical signaling motifs, including:

    • TRAF binding domain (residues 185-211)

    • NF-κB activation region

    • MAPK/ATF, p38, JNK/AP1, and JAK3/STAT signaling activation domains

The membrane-spanning domains facilitate aggregation in the plasma membrane, which is crucial for the transforming capacity of LMP1 .

How does LMP1 activate cellular signaling pathways?

LMP1 functions as a constitutively activated receptor, engaging multiple signaling pathways:

Signaling PathwayLMP1 Domain InvolvedAssociated ProteinsBiological Effect
NF-κBC-terminal domainTRAF family membersUpregulation of anti-apoptotic genes
MAPK/ATFC-terminal domainTRAF2, TRAF6Cell survival, proliferation
JNK/AP1C-terminal domainTRAF2Proliferation, survival
p38 MAPKC-terminal domainTRAF6Inflammatory response
JAK3/STATC-terminal domainJAK3Transcriptional activation

LMP1 interacts with tumor necrosis factor receptor-associated factors (TRAFs) and tumor necrosis factor receptor-associated death domain (TRADD), leading to downstream signaling. Unlike typical receptors, LMP1 does not require ligand binding due to its ability to self-aggregate through its transmembrane domains .

What experimental systems are used to study recombinant LMP1?

Several experimental systems have been developed to study recombinant LMP1:

  • Maxi-EBV system: Allows introduction and study of mutations in the context of the complete EBV genome. This system enables quantitative assessment of different LMP1 domains' contributions to B-cell proliferation .

  • Overlapping EBV cosmids: Used to generate specifically mutated recombinant EBV genomes through transfection into P3HR-1 cells, which contain transformation-defective EBV .

  • Chimeric constructs: Fusion proteins combining LMP1 transmembrane domains with cytoplasmic domains from other receptors (e.g., CD40) to study signaling mechanisms .

  • Cell transformation assays: Used to evaluate the transforming potential of LMP1 mutants in primary B lymphocytes or established rodent fibroblast cell lines .

How can the functional contributions of distinct LMP1 domains be quantitatively assessed?

Quantitative assessment of LMP1 domain contributions requires sophisticated experimental design:

  • Generation of domain-specific mutants: Using the maxi-EBV system, create a panel of EBV mutants with precise alterations in distinct LMP1 domains. Critical modifications include:

    • Deletion of the entire C-terminal domain (ΔC-LMP1)

    • Deletion of specific signaling motifs (e.g., TRAF binding domain)

    • Deletion of transmembrane domains (ΔTM-LMP1)

    • Complete deletion of the LMP1 open reading frame (ΔLMP1)

  • Quantitative transformation assay: Determine the efficiency of mutant viruses to transform primary B lymphocytes by:

    • Infecting primary B cells with equal titers of wild-type and mutant viruses

    • Establishing limiting dilution cultures to determine transformation frequency

    • Measuring the outgrowth kinetics of transformed clones

  • Dependency analysis: Test transformed cells for dependency on feeder cells, which indicates reduced transforming capability. B-cell lines harboring defective LMP1 often require irradiated fibroblast feeder cells for continued proliferation .

  • In vivo assessment: Challenge severe combined immunodeficiency (SCID) mice with transformed cell lines to assess oncogenic potential beyond in vitro transformation capability .

What experimental evidence demonstrates the critical role of the TRAF binding domain in LMP1-mediated transformation?

The essential nature of the TRAF binding domain has been established through targeted mutation studies:

  • Generation of targeted TRAF binding domain mutants: Recombinant EBV genomes with deletion of LMP1 codons 185-211 (LMP1Δ185-211) were created. This mutation eliminates TRAF association while preserving LMP1 stability and localization .

  • Co-infection experimental design: Due to the essential nature of this domain, a sophisticated co-infection approach was used:

    • Primary B lymphocytes were infected with LMP1Δ185-211 EBV recombinant along with P3HR-1 EBV (containing wild-type LMP1 but transformation-defective due to another deletion)

    • Resultant cell lines contained both virus types

  • Secondary infection analysis: Virus from co-infected cell lines (containing approximately equimolar mixtures of wild-type and mutated LMP1 genes) was used to infect new primary B lymphocytes:

    • 412 resultant cell lines contained only wild-type LMP1

    • No transformed cell line contained only the LMP1Δ185-211 gene

    • This segregation pattern clearly demonstrated the critical requirement for the TRAF binding domain

This approach provided definitive molecular genetic evidence that the TRAF binding domain is essential for primary B lymphocyte transformation.

How do transmembrane domains contribute to LMP1 signaling capacity?

The transmembrane domains play a crucial role in LMP1 function through specific mechanisms:

  • Oligomerization mechanism: The six membrane-spanning domains enable LMP1 to self-aggregate in the plasma membrane without requiring ligand binding. This property allows LMP1 to:

    • Form higher-order oligomers

    • Recruit signaling adapters to the C-terminal domain

    • Function as a constitutively active signaling molecule

  • Experimental evidence from deletion studies: Deletion of the transmembrane domains (ΔTM-LMP1) results in:

    • Cytoplasmic localization of the truncated LMP1

    • Remarkably reduced transformation efficiency, even lower than complete LMP1 knockout

    • Evidence of dominant-negative function against wild-type LMP1

  • Quantitative analysis of transmembrane requirement: Deletion of the first four transmembrane domains abrogates LMP1 aggregation in the plasma membrane and nearly abolishes signaling from LMP1 or the LMPCD40 chimera .

The empirical data demonstrates that proper membrane localization through the transmembrane domains is not merely supportive but fundamentally required for LMP1's transforming functions.

What methodological approaches can resolve the apparent contradiction between LMP1 being "essential" yet "not mandatory" for B-cell transformation?

This apparent contradiction requires careful methodological consideration:

  • Definition of "essential" versus "mandatory": While early studies concluded LMP1 was "essential" based on inability to obtain LMP1-null transformants, more sensitive systems have shown transformation can occur without LMP1, albeit at dramatically reduced frequency and with dependency on supportive conditions.

  • Experimental conditions that reveal nuanced requirements:

    • Feeder cell dependency: ΔLMP1 mutants can transform B cells only when cultured with irradiated fibroblast feeder cells, indicating LMP1 functions can be partially compensated by external signals.

    • Quantitative transformation efficiency: ΔLMP1 mutants transform with approximately 10,000-fold reduced efficiency compared to wild-type, explaining why earlier studies missed this capability.

    • In vivo oncogenicity testing: While ΔLMP1 mutants can support limited in vitro proliferation, they completely lack oncogenicity in SCID mice, demonstrating context-dependent essentiality .

  • Experimental modifications to detect rare transformation events:

    • Use higher viral titers

    • Extend observation period beyond standard assay timeframes

    • Implement sensitive detection methods for rare transformants

This methodological approach reconciles the apparent contradiction, demonstrating that LMP1 is critical for efficient transformation but not absolutely required under specific supportive conditions.

How can chimeric receptor approaches advance our understanding of LMP1 signaling mechanisms?

Chimeric receptor approaches provide powerful tools for dissecting LMP1 function:

  • LMP1-CD40 chimera design and rationale:

    • Fusion of LMP1 transmembrane domains with CD40 cytoplasmic domain creates a constitutively active CD40-like receptor

    • This enables direct comparison between LMP1 and CD40 signaling while controlling for receptor activation state

  • Key findings from chimeric studies:

    • The LMPCD40 chimera activates NF-κB similar to LMP1

    • Both LMPCD40 and LMP1 induce stress-activated protein kinase activity without ligand

    • The LMPCD40 chimera upregulates epidermal growth factor receptor similar to LMP1

    • Deletion of the first four transmembrane domains abolishes signaling from both LMP1 and the chimera

  • Methodological advantages:

    • Isolates the contribution of transmembrane domains from signaling domains

    • Enables creation of constitutively active versions of normally ligand-dependent receptors

    • Allows direct comparison of downstream signaling events in identical cellular contexts

This approach has highlighted LMP1's role as a constitutively active receptor similar to CD40 and provided a novel methodology for generating ligand-independent receptors for research purposes.

What are the optimal systems for studying LMP1 mutations in the context of the complete viral genome?

The maxi-EBV system represents the state-of-the-art approach for studying LMP1 in the context of the complete viral genome:

  • Technical components of the maxi-EBV system:

    • Complete EBV genome maintained as a bacterial artificial chromosome (BAC)

    • F-factor plasmid backbone allowing stable propagation in E. coli

    • Selectable markers for both bacterial and mammalian selection

    • Green fluorescent protein (GFP) gene for visualizing infected cells

  • Methodological workflow:

    • Generate LMP1 mutations in the maxi-EBV through homologous recombination in bacteria

    • Verify mutants by restriction digestion and sequencing

    • Transfect verified constructs into suitable producer cell lines (e.g., HEK293)

    • Induce viral replication and harvest infectious virions

    • Infect primary B lymphocytes and establish cell lines

    • Analyze transformation efficiency, growth characteristics, and signaling

  • Advantages over previous recombinant systems:

    • Allows precise genetic modifications without altering other viral functions

    • Enables quantitative assessment of transformation efficiency

    • Permits study of mutations that would be lethal in traditional approaches

    • Facilitates direct comparison of multiple mutants under identical conditions

The maxi-EBV system has been instrumental in revealing the nuanced contributions of LMP1 domains to B-cell transformation that were not apparent with earlier techniques.

What experimental controls are critical when evaluating LMP1 mutants?

  • Critical experimental controls:

    Control TypePurposeImplementation
    Wild-type LMP1Positive control for transformationParallel infection with wild-type EBV from same producer cells
    LMP1 deletionNegative control for LMP1-dependent effectsComplete deletion of LMP1 open reading frame
    Feeder cell controlsDistinguish cell-autonomous effectsParallel cultures with and without feeder layers
    Expression level controlsAccount for protein abundance effectsWestern blot quantification of LMP1 mutant expression
    Coinfection controlsIdentify complementation effectsPCR analysis of viral genomes in transformed cells
  • Addressing confounding variables:

    • Protein stability: Assess the half-life of mutant LMP1 proteins to ensure observed phenotypes are not due to altered protein turnover.

    • Subcellular localization: Confirm proper localization of mutant proteins through immunofluorescence microscopy.

    • Expression timing: Use inducible expression systems to control when mutant LMP1 is expressed during the transformation process .

  • Donor variability considerations:

    • Use B cells from multiple donors to account for genetic variability

    • Include paired wild-type and mutant infections from the same donor

    • Pool data across experiments to strengthen statistical validity

How can researchers effectively analyze the complex signaling network activated by LMP1?

Comprehensive analysis of LMP1 signaling requires multi-faceted approaches:

  • Biochemical approaches:

    • Co-immunoprecipitation: Identify direct interaction partners of LMP1 and specific domains.

    • In vitro kinase assays: Measure activation of downstream kinases like JNK, p38 MAPK.

    • Electrophoretic mobility shift assays (EMSA): Assess transcription factor activation (e.g., NF-κB).

    • Phospho-specific Western blotting: Track activation state of signaling components.

  • Genetic approaches:

    • Domain-specific mutations: Target individual motifs within LMP1 C-terminus.

    • siRNA/shRNA knockdown: Systematically silence candidate downstream effectors.

    • CRISPR-Cas9 knockout: Generate clean genetic backgrounds lacking specific pathway components.

  • Systems biology approaches:

    • Phospho-proteomics: Global analysis of phosphorylation changes induced by LMP1.

    • Transcriptomics: RNA-seq to identify gene expression networks regulated by LMP1.

    • Network analysis: Computational modeling of signaling pathway integration.

    • Temporal analysis: Time-course experiments to distinguish primary from secondary effects .

  • Experimental verification of pathway integration:

    • Use of specific pathway inhibitors to block individual branches of LMP1 signaling

    • Rescue experiments with constitutively active downstream effectors

    • Epistasis analysis to establish hierarchical relationships between signaling components

These approaches collectively enable a comprehensive understanding of how LMP1 integrates multiple signaling pathways to drive cellular transformation.

How can findings from recombinant LMP1 research inform therapeutic approaches for EBV-associated malignancies?

Research on recombinant LMP1 provides several promising therapeutic targets:

  • Critical domains for therapeutic targeting:

    • TRAF binding domain (aa 185-211): Essential for transformation, making it an attractive target for small molecule inhibitors .

    • Transmembrane domains: Required for oligomerization and signaling; could be targeted by membrane-disrupting peptides .

    • C-terminal signaling domains: Multiple distinct motifs that activate different pathways, allowing targeted inhibition of specific oncogenic signals .

  • Downstream pathway targeting strategies:

    • NF-κB pathway inhibitors: May selectively affect LMP1-driven tumors due to their dependence on this pathway.

    • Combined JNK/p38 MAPK inhibition: Could synergistically block LMP1-mediated survival and proliferation signals.

    • JAK3/STAT inhibitors: May disrupt LMP1-specific transcriptional programs.

  • Experimental models for therapeutic testing:

    • Recombinant EBV-transformed LCLs with wild-type or mutant LMP1

    • SCID mouse models bearing LMP1-expressing tumors

    • Patient-derived xenografts from EBV-positive tumors

  • Methodological considerations for therapeutic development:

    • Screen for compounds that disrupt LMP1 oligomerization

    • Develop peptide mimetics of critical LMP1 interaction domains

    • Design immunotherapeutic approaches targeting LMP1-expressing cells

The extensive molecular understanding of LMP1 function provides rational approaches for therapeutic intervention in EBV-associated malignancies.

What insights from recombinant LMP1 studies can be applied to understanding other viral oncoproteins?

LMP1 research offers valuable paradigms for studying other viral oncoproteins:

  • Conceptual frameworks transferable to other systems:

    • Constitutive activation through self-oligomerization

    • Mimicry of cellular receptor signaling

    • Integration of multiple downstream pathways

    • Conversion of proliferation signals into transformation

  • Methodological approaches applicable to other viral oncoproteins:

    • Domain-by-domain functional mapping through recombinant viral genomes

    • Chimeric protein construction to isolate specific functional domains

    • Quantitative transformation assays to measure subtle functional differences

    • Co-infection strategies to study essential viral functions

  • Comparative analysis opportunities:

    • Compare LMP1 with other herpesvirus oncoproteins

    • Analyze similarities with retroviral transforming proteins

    • Identify convergent mechanisms among diverse viral oncoproteins

    • Develop unified models of viral transformation mechanisms

The systematic approaches developed for LMP1 study provide a template for comprehensive analysis of other viral oncoproteins, potentially revealing common therapeutic targets.

What emerging technologies might advance our understanding of LMP1 structure-function relationships?

Several cutting-edge technologies offer new opportunities for LMP1 research:

  • Structural biology approaches:

    • Cryo-electron microscopy to visualize LMP1 oligomers in membranes

    • Single-particle analysis of LMP1 signaling complexes

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Computational modeling of transmembrane domain interactions

  • Advanced genetic engineering:

    • CRISPR-Cas9 base editing for precise single amino acid substitutions

    • Optogenetic control of LMP1 signaling complexes

    • Synthetic genomics approaches to create minimal EBV genomes

    • In situ tagging of endogenous LMP1 in latently infected cells

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in LMP1 responses

    • Single-cell proteomics to profile signaling in individual cells

    • Live-cell imaging of LMP1 trafficking and complex formation

    • Single-molecule tracking to analyze LMP1 dynamics in membranes

  • Integrative multi-omics approaches:

    • Correlate LMP1 structure-function relationships with global cellular states

    • Develop predictive models of LMP1 signaling networks

    • Map the complete LMP1 interactome under various conditions

    • Analyze temporal dynamics of LMP1-induced cellular reprogramming

These technologies promise to reveal previously inaccessible aspects of LMP1 biology and potentially identify novel therapeutic vulnerabilities.

How might systematic mutagenesis approaches further refine our understanding of critical LMP1 functional motifs?

Systematic mutagenesis offers powerful approaches to dissect LMP1 function:

  • Deep mutational scanning:

    • Generate libraries of thousands of LMP1 variants with single amino acid substitutions

    • Screen for transformation efficiency or specific pathway activation

    • Map functional significance of each residue in critical domains

    • Identify subtle contributions missed by traditional deletion studies

  • Alanine-scanning mutagenesis of critical domains:

    • Methodically replace each residue in the TRAF binding domain with alanine

    • Quantitatively assess impact on transformation and signaling

    • Identify "hotspot" residues critical for protein-protein interactions

    • Define the minimal functional motifs within larger domains

  • Cross-species chimera analysis:

    • Create chimeric proteins between LMP1 and its homologs from related viruses

    • Map functional conservation and divergence across evolutionary distance

    • Identify invariant motifs that represent core functional elements

    • Discover species-specific adaptations that might reveal novel functions

  • Synthetic biology approaches:

    • Design artificial LMP1 variants with novel combinations of functional domains

    • Test sufficiency of minimal domains for specific LMP1 functions

    • Create conditionally active LMP1 variants for temporal control

    • Develop orthogonal signaling systems based on LMP1 architecture

These systematic approaches will generate comprehensive functional maps of LMP1, potentially revealing new therapeutic targets and fundamental principles of viral oncoprotein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.