Recombinant Epstein-Barr virus Glycoprotein BDLF3 (BDLF3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BDLF3; Glycoprotein BDLF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-234
Protein Length
Full Length of Mature Protein
Species
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Target Names
BDLF3
Target Protein Sequence
SSTASAGNVTGTTAVTTPSPSASGPSTNQSTTLTTTSAPITTTAILSTNTTTVTFTGTTV TPVPTTSNASTINVTTKVTAQNITATEAGTGTSTGVTSNVTTRSSSTTSATTRITNATTL APTLSSKGTSNATKTTAELPTVPDERQPSLSYGLPLWTLVFVGLTFLMLILIFAAGLMMS AKNKPLDEALLTNAVTRDPSLYKGLV
Uniprot No.

Target Background

Gene References Into Functions
  1. BDLF3 enhances the internalization of surface major histocompatibility complex (MHC) molecules and reduces their reappearance on the cell surface. PMID: 26468525
Database Links

KEGG: vg:3783694

Protein Families
Epstein-Barr virus BDLF3 protein family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the predicted structure of the BDLF3 glycoprotein?

BDLF3 is predicted to be a glycoprotein based on its sequence characteristics, including signal peptide features and transdomain elements. The protein contains nine potential N-linked glycosylation sites, suggesting extensive post-translational modifications. Western blot analyses of B95-8 cell lysates, partially purified virus preparations, and infected cell membranes have detected a diffuse band with a molecular mass of 100-150 kDa when probed with anti-BDLF3 peptide serum . This size variability is consistent with the predicted glycosylation pattern of the protein.

How conserved is BDLF3 among herpesviruses?

BDLF3 appears to be unique to Epstein-Barr virus as no sequential or positional homologues have been identified in other herpesviruses . This lack of conservation suggests that BDLF3 may perform specialized functions specific to EBV's lifecycle and host interaction strategies. The uniqueness of BDLF3 makes it a potentially valuable target for developing EBV-specific diagnostic tools and therapeutic strategies.

How does BDLF3 contribute to EBV immune evasion?

BDLF3 plays a crucial role in EBV immune evasion by downregulating the expression of both surface major histocompatibility complex (MHC) class I and class II molecules . This dual targeting makes BDLF3 a rare example of a viral protein that impairs both the MHC class I and class II antigen-presenting pathways. BDLF3 functions by enhancing internalization of surface MHC molecules while simultaneously reducing their rate of appearance at the cell surface. This directly impacts the recognition of infected cells by both CD8+ and CD4+ T lymphocytes, protecting the virus from immune surveillance.

What is the molecular mechanism of MHC downregulation by BDLF3?

BDLF3 induces ubiquitination of MHC molecules, targeting them for subsequent downregulation through a proteasome-dependent mechanism . This process affects the stability and trafficking of MHC molecules, resulting in reduced presentation of viral antigens to immune cells. The specific cellular machinery that BDLF3 recruits to accomplish ubiquitination remains an area of ongoing research, but the functional consequence of this mechanism is efficient protection against T cell recognition.

How does BDLF3-mediated immune evasion differ from other EBV immune evasion strategies?

BDLF3 represents a distinct immune evasion mechanism that operates specifically during the late lytic cycle of EBV infection . While other immune evasion mechanisms like BILF1 function earlier in the lytic cycle, BDLF3 provides additional protection when late lytic antigens are being expressed. This explains why CD8+ T cells specific for late lytic cycle antigens show particularly poor recognition of target cells compared to those recognizing immediate early and early antigens. The temporal regulation of multiple immune evasion strategies reveals the sophisticated evolutionary adaptation of EBV to human immune responses.

When is BDLF3 expressed during the EBV life cycle?

BDLF3 is classified as a late lytic gene in the EBV life cycle . In experimental systems, its expression can be initiated by transfecting EBV-positive cells with an expression plasmid encoding BZLF1, which triggers the switch from latent to lytic phase . The late expression timing of BDLF3 corresponds with its function in protecting cells producing viral particles from immune recognition, which becomes increasingly important as viral antigens accumulate during the late phases of replication.

How is BDLF3 expression regulated at the transcriptional level?

Transcriptional regulation of BDLF3 involves several key factors. ChIP data show that AP-1(A/S) and ZEBRA bind with similar affinities to the promoters of BDLF3 . Like other late lytic genes, BDLF3 expression requires the presence of six genes unique to β- and γ-herpesviruses (BcRF1, BDLF3.5, BDLF4, BFRF2, BGLF3, and BVLF1) . Additionally, activation of late-gene promoters requires thymidine at the fourth position of the non-canonical TATT sequence and, critically, depends on OriLyt-mediated DNA replication .

What is the relationship between viral DNA replication and BDLF3 expression?

BDLF3, like other late lytic genes, requires OriLyt-mediated DNA replication in cis for its expression . This unique requirement distinguishes late genes from early genes, which can be expressed independently of viral DNA replication. The dependence on DNA replication may involve structural changes to newly replicated viral DNA that facilitate accessibility to transcription factors or the assembly of specialized transcriptional complexes at late gene promoters within viral replication factories.

What systems can be used to study recombinant BDLF3 expression and function?

Several experimental systems have been used to study BDLF3:

  • Bacterial expression systems: GST-BDLF3 fusion proteins can be produced in bacteria and used for antibody generation and serological studies .

  • Baculovirus expression systems: Recombinant baculoviruses (e.g., AcBDLF3) can express BDLF3 in insect cells for functional and structural studies .

  • EBV BACmid systems: Using EBV BACmids with specific mutations allows for studying the role of BDLF3 in the context of the complete viral genome .

  • Cell culture models: HEK293 cells harboring EBV genomes provide a useful system for investigating BDLF3 function during lytic reactivation .

These diverse systems enable comprehensive investigation of different aspects of BDLF3 biology.

How can researchers detect BDLF3 expression in experimental systems?

BDLF3 can be detected through multiple complementary approaches:

  • Western blotting: Using anti-BDLF3 peptide or fusion protein antibodies against cell lysates or virus preparations .

  • Indirect immunofluorescence: Anti-peptide serum has successfully detected BDLF3 products in acetone-fixed EBV-infected B cells .

  • RT-qPCR and Northern blotting: These techniques can assess BDLF3 mRNA expression levels .

  • Enzymatic deglycosylation: Treatment with neuraminidase, O-glycosidase, or N-glycosidase F followed by Western blotting can reveal insights into BDLF3 glycosylation .

The diffuse nature of the glycosylated BDLF3 band (100-150 kDa) should be considered when designing detection strategies.

What approaches can be used to study BDLF3-mediated MHC downregulation?

Researchers investigating BDLF3's role in MHC downregulation can employ several approaches:

  • Flow cytometry to measure surface MHC levels in cells expressing recombinant BDLF3.

  • Pulse-chase experiments to examine the rates of MHC internalization and surface appearance.

  • Immunoprecipitation and ubiquitination assays to detect BDLF3-induced ubiquitination of MHC molecules.

  • Proteasome inhibitors to confirm the proteasome-dependent nature of MHC downregulation.

  • T cell recognition assays to assess functional consequences of BDLF3 expression on CD4+ and CD8+ T cell responses .

These complementary approaches allow for a comprehensive characterization of the mechanisms underlying BDLF3's immune evasion function.

How can BDLF3 knockout or mutant viruses be generated for functional studies?

Generation of BDLF3 mutant viruses can be accomplished using EBV BACmid technology. The En Passant method allows for precise genetic modifications without leaving behind unwanted sequences . Key steps in this process include:

  • Design of targeting constructs containing selection markers and homology arms.

  • Recombination in E. coli to introduce the desired mutation into the BACmid.

  • Verification of the mutation by sequencing and restriction digestion analysis.

  • Transfection of the mutant BACmid into 293 cells to establish producer cell lines.

  • Induction of the lytic cycle using BZLF1 expression to evaluate phenotypes.

Complementation assays, where the mutant virus is rescued by providing the wild-type gene in trans, serve as important controls to confirm that observed phenotypes result specifically from the BDLF3 mutation.

What is the comparative activation profile of BDLF3 in relation to other EBV genes?

Quantitative analysis of BDLF3 activation shows the following profile in comparison to other viral genes:

GeneFunction% activation by qPCR (Array 1)% activation by qPCR (Array 2)% activation by RT-qPCR
BBLF1MyrP347100124
BBRF1Portal protein, U16 homolog4205686
BBRF2Egress protein, UL7 homolog2227386
BDLF3gp150, immune evasion7010447
BGRF1Tripartite terminase subunit UL15 homolog10990158
BKRF2Envelope glycoprotein LND9789
BKRF4Tegument protein40011384
BLLF3Deoxyuridine 5′ triphosphate nucleotidohydrolaseND8473
BLRF1Glycoprotein N42688119

This data indicates that BDLF3 shows variable activation levels (70-104% in qPCR arrays and 47% in RT-qPCR) compared to other viral genes . The differences in activation profiles may reflect distinct regulatory mechanisms controlling different functional classes of viral genes.

How does BDLF3 interact with the viral transcription machinery during late gene expression?

BDLF3 expression itself depends on a viral pre-initiation complex encoded by six EBV βγ genes (BcRF1, BDLF3.5, BDLF4, BFRF2, BGLF3, and BVLF1) . This complex mediates late gene transcription from newly replicated viral DNA. The process involves:

  • Viral DNA replication at OriLyt-containing regions.

  • Formation of nuclear replication factories devoid of histones and cellular DNA.

  • Assembly of the viral pre-initiation complex at late gene promoters containing the non-canonical TATT element.

  • Transcription initiation dependent on the replicated state of the DNA template.

These interactions highlight the complex interconnection between viral DNA replication and gene expression programs, with BDLF3 serving as both a target of this specialized transcription mechanism and a functional effector in immune evasion.

What is the immunological significance of BDLF3 in EBV-infected individuals?

The immunological significance of BDLF3 is evidenced by serological studies showing that over one-third of EBV-immune human sera tested recognized GST-BDLF3 fusion protein but not GST alone on Western blots . This indicates that BDLF3 is immunogenic in natural EBV infections despite its immune evasion functions. The balance between BDLF3-mediated immune evasion and host recognition of this protein likely contributes to the establishment of EBV persistence in human populations. Understanding this balance could provide insights into how different individuals control EBV infection and why some develop EBV-associated diseases.

How might targeting BDLF3 contribute to novel EBV therapeutic strategies?

As a key player in immune evasion during the late lytic cycle, BDLF3 represents a potential target for novel therapeutic approaches. Strategies might include:

  • Small molecule inhibitors of BDLF3 that could block its MHC downregulation function, thereby enhancing immune recognition of lytically infected cells.

  • Immunotherapeutic approaches targeting BDLF3 epitopes, leveraging the observation that it is recognized by EBV-immune sera.

  • Gene editing approaches to disrupt BDLF3 function in EBV-positive tumors undergoing lytic reactivation.

The uniqueness of BDLF3 to EBV (with no homologues in other herpesviruses) makes it particularly attractive as a specific target that could minimize off-target effects on related viruses or host proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.