Recombinant Epstein-Barr virus Probable membrane glycoprotein (BILF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BILF2; Glycoprotein BILF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-248
Protein Length
Full Length of Mature Protein
Species
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Target Names
BILF2
Target Protein Sequence
FFSDLVKFENVTAHAGARVNLTCSVPSNESVSRIELGRGYTPGDGQLPLAVATSNNGTHI TNGGYNYSLTLEWVNDSNTSVSLIIPNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEE DDQYHANRTLTQRMHLTVIPATTIAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFP IDPWRPKTTWVHWALLLITCAVVAPVLLIIIISCLGWLAGWGRRRKGWIPL
Uniprot No.

Target Background

Database Links

KEGG: vg:3783708

Protein Families
Epstein-Barr virus BILF2 protein family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic location and basic structure of the BILF2 gene in Epstein-Barr virus?

The BILF2 open reading frame in EBV is located at B95-8 nucleotides 150,525 to 149,782. Computer-assisted analysis predicts that it codes for a membrane-bound glycoprotein with a single-pass type 1 membrane orientation. The unmodified BILF2 gene product has a predicted molecular mass of approximately 28 kilodaltons, though extensive glycosylation significantly increases its apparent molecular weight in viral-producing cells.

How is BILF2 typically expressed and processed in EBV-infected cells?

BILF2 is expressed during the late lytic/structural phase of EBV replication. When expressed in cells, BILF2 undergoes extensive N-linked glycosylation, resulting in diffuse glycoprotein species of approximately 78-80 kDa and 55 kDa as detected by [³H]glucosamine labeling and immunoprecipitation techniques. N-Glycanase treatment of the immunoprecipitated BILF2 from EBV-producing cells reduces it to a 28 kDa polypeptide, confirming that the higher molecular weight forms result from post-translational glycosylation.

What experimental systems have been used to study recombinant BILF2?

Recombinant BILF2 has been primarily studied using vaccinia virus expression systems. In these experiments, vaccinia virus recombinants expressing the BILF2 open reading frame have been constructed to produce the glycoprotein in cell culture. This approach has allowed researchers to characterize the biochemical properties of BILF2 independent of other EBV proteins. Immunoprecipitation and Western blot techniques using monoclonal antibodies derived from mice immunized with EBV have been instrumental in identifying and characterizing the recombinant protein.

What are the optimal expression systems for producing recombinant BILF2 protein for structural and functional studies?

While vaccinia virus recombinants have historically been used to express BILF2, researchers should consider several factors when selecting an expression system. For structural studies requiring properly glycosylated BILF2, mammalian expression systems (such as HEK293 or CHO cells) are preferable over bacterial or insect cell systems. Codon optimization of the BILF2 sequence for the host cell line can improve expression levels. For functional studies, inducible expression systems allow temporal control of BILF2 expression, which may be critical when investigating potential cytotoxic effects or interactions with cellular pathways. When designing expression constructs, include epitope tags (such as His, FLAG, or HA) that do not interfere with BILF2 trafficking or membrane orientation.

What purification strategies are most effective for isolating recombinant BILF2 while preserving its native conformation?

Purification of membrane proteins like BILF2 requires specialized approaches to maintain protein integrity. A recommended protocol includes: (1) Gentle solubilization of membranes using non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin; (2) Affinity chromatography using either antibodies against BILF2 or epitope tags engineered into the recombinant protein; (3) Size exclusion chromatography to separate different oligomeric states; (4) For structural studies, consider detergent exchange or reconstitution into nanodiscs or liposomes to better mimic the native membrane environment. Quality control should include glycosylation profiling using lectins or mass spectrometry to ensure proper post-translational modification patterns.

How can researchers effectively develop and validate antibodies against BILF2 for research applications?

Developing specific antibodies against BILF2 requires strategic epitope selection and validation. Researchers should: (1) Identify both conserved and variable regions within BILF2 using sequence analysis across EBV strains; (2) Generate immunogens from recombinant BILF2 fragments expressed in eukaryotic systems to preserve glycosylation patterns; (3) Immunize mice or rabbits with these fragments and screen hybridomas not only against recombinant protein but also against EBV-producing cells; (4) Validate antibody specificity using knockdown or knockout controls; (5) Characterize each antibody's applications (western blot, immunoprecipitation, flow cytometry, etc.) systematically. Monoclonal antibodies derived from mice immunized with EBV have successfully detected BILF2 in previous studies and can serve as positive controls for new antibody development efforts.

What approaches can researchers use to elucidate the currently unknown function of BILF2?

To investigate BILF2's function, researchers should pursue multiple complementary approaches: (1) Gene knockout studies using CRISPR-Cas9 in EBV bacterial artificial chromosomes (BACs) to assess the impact on viral replication, assembly, and egress; (2) Protein-protein interaction studies using techniques such as proximity labeling (BioID, APEX), co-immunoprecipitation coupled with mass spectrometry, and yeast two-hybrid screening to identify cellular and viral binding partners; (3) Subcellular localization studies using confocal microscopy with fluorescently tagged BILF2 in various stages of the viral life cycle; (4) Comparative analyses with other betaherpesvirus and gammaherpesvirus glycoproteins that share structural similarities; (5) Host gene expression profiling in cells expressing BILF2 versus controls using RNA-seq or proteomics to identify affected pathways.

How does BILF2 compare functionally to other EBV glycoproteins in the viral life cycle?

Unlike well-characterized EBV glycoproteins such as gp350/220 (involved in attachment), gB (involved in fusion), gH/gL complex and gp42 (involved in regulation and triggering of fusion), BILF2's role remains undefined. Experimental approaches to compare BILF2 with other glycoproteins include: (1) Temporal expression analysis during the viral replication cycle; (2) Co-localization studies with known structural or functional glycoprotein complexes; (3) Competition assays to determine if BILF2 modulates the function of other glycoproteins; (4) Analysis of incorporation into virions compared to other glycoproteins; (5) Comparative analysis of conservation across EBV strains as an indicator of functional importance. These comparisons may reveal whether BILF2 functions in viral entry, assembly, immune evasion, or other processes.

What is known about the immunological significance of BILF2 in EBV infection?

Western blot analyses using recombinant infected cells as antigen sources have demonstrated that the majority of EBV-seropositive individuals develop antibody responses to BILF2-encoded gp78/55. This suggests BILF2 is immunogenic during natural EBV infection. Researchers investigating BILF2's immunological significance should: (1) Characterize the kinetics and magnitude of anti-BILF2 antibody responses during primary EBV infection versus long-term carriage; (2) Assess whether anti-BILF2 antibodies possess neutralizing activity; (3) Investigate whether BILF2 contains T cell epitopes recognized by CD4+ or CD8+ T cells; (4) Determine if BILF2, like some other viral glycoproteins, plays a role in immune evasion; (5) Evaluate whether anti-BILF2 immune responses correlate with protection from EBV-associated diseases.

How might BILF2 contribute to EBV-associated diseases and pathogenesis?

While BILF2's specific role in pathogenesis remains undefined, researchers can investigate potential contributions through: (1) Comparative expression analysis of BILF2 in different EBV-associated malignancies and diseases using immunohistochemistry and transcriptomic approaches; (2) Creation of BILF2-deficient EBV strains to assess impact on viral persistence, reactivation, and disease development in animal models; (3) Analysis of whether BILF2 influences epithelial or B cell tropism, potentially affecting tissue-specific pathogenesis; (4) Investigation of whether BILF2 variants correlate with disease risk or progression in epidemiological studies; (5) Assessment of BILF2's potential interactions with innate immune pathways that might influence disease development. Understanding these aspects could reveal whether BILF2 represents a potential therapeutic target.

What experimental designs would best evaluate BILF2 as a potential vaccine antigen against EBV?

Despite extensive EBV vaccine research focusing primarily on gp350, evaluating BILF2 as a vaccine component requires systematic approaches: (1) Production of recombinant BILF2 with native conformation and glycosylation patterns for immunization studies; (2) Comparison of different delivery platforms (monomeric protein, virus-like particles, viral vectors) for optimal BILF2 presentation; (3) Evaluation of BILF2-specific antibody responses, including neutralizing capacity and Fc-mediated functions; (4) Assessment of BILF2-specific T cell responses; (5) Challenge studies in appropriate animal models to evaluate protection; (6) Comparative studies with other EBV antigens to determine if BILF2 provides complementary or synergistic protection. These studies would determine whether BILF2 merits inclusion in multi-antigen EBV vaccine candidates.

What mass spectrometry approaches are most suitable for characterizing BILF2 glycosylation patterns?

Characterizing the extensive N-linked glycosylation of BILF2 requires specialized mass spectrometry approaches: (1) Sample preparation should include enrichment of glycopeptides using lectin affinity or hydrophilic interaction liquid chromatography; (2) For intact glycoprotein analysis, native MS or top-down proteomics can provide information on glycoform distributions; (3) For site-specific glycosylation, enzymatic digestion followed by LC-MS/MS analysis with ETD or EThcD fragmentation is recommended; (4) Glycan release using PNGase F followed by permethylation and MALDI-TOF MS can provide detailed glycan profiles; (5) For comparative studies between recombinant and native BILF2, parallel reaction monitoring can provide quantitative data on specific glycoforms. These approaches would clarify how glycosylation contributes to BILF2's structure and potential function.

How can structural biology techniques be applied to determine the three-dimensional structure of BILF2?

Membrane proteins like BILF2 present challenges for structural determination. Recommended approaches include: (1) Cryo-electron microscopy of purified BILF2 reconstituted in nanodiscs or detergent micelles; (2) X-ray crystallography of the ectodomain, potentially facilitated by removal of flexible glycan moieties or generation of stable antibody complexes; (3) Nuclear magnetic resonance spectroscopy of specific domains; (4) Hydrogen-deuterium exchange mass spectrometry to map surface accessibility and protein dynamics; (5) Integrative structural biology combining experimental data with computational modeling. Researchers should also consider expressing and analyzing separate domains of BILF2 if the full-length protein proves refractory to structural determination.

What computational tools and approaches are valuable for predicting BILF2 function based on sequence and structural features?

In the absence of experimental functional data, computational approaches can provide valuable insights: (1) Advanced homology modeling using AlphaFold2 or RoseTTAFold to predict structural features; (2) Molecular dynamics simulations to understand membrane interactions and conformational flexibility; (3) Ligand binding site prediction using tools like FTSite or SiteMap; (4) Evolutionary analysis using methods like PAML to identify sites under positive selection; (5) Protein-protein interaction prediction using template-based or machine learning approaches; (6) Gene ontology and pathway enrichment analysis of predicted interaction partners. Results from these computational analyses can generate testable hypotheses about BILF2 function and guide experimental designs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.