Recombinant Epstein-Barr virus Virion egress protein BFRF1 (BFRF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
NEC2; BFRF1; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Target Names
NEC2
Target Protein Sequence
MASPEERLLDELNNVIVSFLCDSGSLEVERCSGAHVFSRGSSQPLCTVKLRHGQIYHLEF VYKFLAFKLKNCNYPSSPVFVISNNGLATTLRCFLHEPSGLRSGQSGPCLGLSTDVDLPK NSIIMLGQDDFIKFKSPLVFPAELDLLKSMVVCRAYITEHRTTMQFLVFQAANAQKASRV MDMISDMSQQLSRSGQVEDTGARVTGGGGPRPGVTHSGCLGDSHVRGRGGWDLDNFSEAE TEDEASYAPWRDKDSWSESEAAPWKKELVRHPIRRHRTRETRRMRGSHSRVEHVPPETRE TVVGGAWRYSWRATPYLARVLAVTAVALLLMFLRWT
Uniprot No.

Target Background

Function
BFRF1 plays a crucial role in virion nuclear egress, the initial step of viral release from infected cells. Within the host nucleus, BFRF1 interacts with the newly formed capsid via its vertices, directing it to the inner nuclear membrane through its association with NEC2. This interaction initiates capsid budding at the inner nuclear membrane and subsequent envelopment within the perinuclear space. The BFRF1/NEC2 complex facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm where it proceeds to secondary budding sites in the Golgi apparatus or trans-Golgi network.
Gene References Into Functions
  1. Epstein-Barr virus early lytic protein BFRF1 alters emerin distribution and post-translational modifications. PMID: 28238874
  2. This research demonstrates that Itch, ubiquitin, and Alix regulate BFRF1-mediated modulation of the nuclear envelope and human herpesvirus 4 maturation, revealing novel regulatory mechanisms for viral nucleocapsid nuclear egress. PMID: 27466427
  3. BFRF1 recruits ESCRT components to modulate the nuclear envelope for EBV nuclear egress. PMID: 22969426
  4. This study identified a ZEBRA-responsive element (ZRE) and an RTA-responsive element (RRE) within the BFRF1 promoter region. PMID: 16406456
Database Links

KEGG: vg:3783699

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is the BFRF1 protein in Epstein-Barr virus?

BFRF1 is an early lytic protein of Epstein-Barr virus that functions as a virion egress protein. It is the positional homolog of herpes simplex virus type 1 and pseudorabies virus UL34 protein. BFRF1 is essential for efficient primary viral envelopment and nuclear egress of viral particles. It is expressed early during EBV lytic replication and consists of 336 amino acids, with amino acids 80-291 being critical for its function . The protein has been shown to play a dual role in facilitating viral maturation and suppressing host immune responses .

What is the cellular localization of BFRF1 during EBV lytic replication?

BFRF1 is predominantly localized to the nuclear membrane during EBV lytic replication. Immunostaining studies have shown that BFRF1 accumulates preferentially in areas where budding of nucleocapsids occurs underneath the nuclear membrane . This localization pattern is consistent with its function in viral nuclear egress. When visualizing BFRF1 localization, immunofluorescence microscopy using specific monoclonal antibodies such as anti-BFRF1 E7 is recommended. The characteristic nuclear rim staining pattern distinguishes BFRF1 from other viral proteins and confirms its association with the nuclear envelope .

How is BFRF1 expression regulated during the EBV lytic cycle?

BFRF1 is expressed early during the EBV lytic cycle following the activation of the immediate-early gene BZLF1 (also known as ZEBRA or Zta). The expression of BFRF1 can be experimentally induced in latently infected cells by transfecting them with a BZLF1 expression plasmid. RT-qPCR analysis can be used to quantify BFRF1 mRNA levels during different stages of viral replication. For protein detection, Western blotting with anti-BFRF1 antibodies or epitope tag antibodies (when using tagged recombinant versions) provides reliable quantification of expression levels .

What are the key domains of BFRF1 essential for its function?

The functional domains of BFRF1 have been identified through deletion and mutation analyses. Research has shown that amino acids 80-291 of the 336-amino-acid BFRF1 protein are critical for its function in viral maturation . This region likely contains domains responsible for membrane association and protein-protein interactions with viral and cellular factors. For researchers investigating BFRF1 structure-function relationships, site-directed mutagenesis approaches targeting conserved residues within this region, followed by complementation assays in BFRF1-KO systems, can identify specific residues critical for nuclear egress functions.

How does BFRF1 contribute to EBV virion maturation?

BFRF1 plays a critical role in the nuclear egress of EBV nucleocapsids, which is a key step in virion maturation. Electron microscopic observations of cells infected with BFRF1-knockout virus have revealed that viral nucleocapsids become sequestered in the nucleus when BFRF1 is absent . The protein facilitates the primary envelopment process where nucleocapsids bud through the inner nuclear membrane into the perinuclear space. Researchers investigating this process should employ electron microscopy to visualize the different stages of viral particle maturation in cells expressing or lacking BFRF1. Complementation experiments have demonstrated that reintroduction of BFRF1 into BFRF1-KO infected cells restores viral titers to levels similar to those of wild-type virus, confirming its essential role in virion maturation and egress .

How can researchers generate BFRF1 knockout EBV mutants?

To generate BFRF1 knockout EBV mutants, researchers can employ a bacterial artificial chromosome (BAC) recombineering approach. The following methodology has been successfully used:

  • Begin with an EBV BAC system such as p2089, which contains the complete EBV genome with selectable markers.

  • Create a targeting vector by replacing the BFRF1 gene (e.g., coordinates 58875 to 59493 in the B95-8 strain) with an antibiotic resistance marker (e.g., tetracycline resistance gene) flanked by Flp recombinase recognition sites.

  • Transform the linearized targeting vector into a bacterial strain carrying the EBV BAC to induce homologous recombination.

  • Select recombinant clones using appropriate antibiotics (chloramphenicol and tetracycline).

  • Remove the antibiotic resistance marker using Flp recombinase to minimize disruption of adjacent genes.

  • Confirm the successful deletion by restriction enzyme analysis and Southern blotting using BFRF1-specific probes.

  • Analyze the integrity of adjacent genes (particularly BFRF2) and the terminal repeat (TR) region by Southern blotting to ensure specific modification of only the BFRF1 gene .

What cell lines are optimal for studying BFRF1 function?

For studying BFRF1 function, several cell lines have proven effective:

  • HEK293 cells: These cells are highly transfectable and permissive for EBV replication, making them ideal for establishing stable cell lines harboring recombinant EBV genomes. They can be easily transfected with BZLF1 to induce the lytic cycle .

  • HEK293T cells: These cells are suitable for transient transfection experiments to study protein-protein interactions, signaling pathway modifications, and reporter assays for investigating BFRF1's role in immune evasion .

  • EBV-positive epithelial cells like Hone1: These cells are valuable for studying the function of BFRF1 in the context of natural EBV infection and lytic reactivation. They can be used with RNA interference approaches to knock down BFRF1 expression .

  • B lymphocytes from umbilical cord blood: These cells are essential for assessing the impact of BFRF1 mutations on B cell immortalization, an important aspect of EBV biology .

Does BFRF1 deletion affect viral DNA replication?

BFRF1 deletion does not appear to affect viral DNA replication. Gardella gel assays performed on 293-BFRF1-KO cells have shown that viral DNA replication proceeds normally in the absence of BFRF1 . Additionally, the expression of immediate-early, early, and late viral proteins remains unaffected in BFRF1-knockout virus-infected cells following induction of the lytic cycle. This indicates that BFRF1 functions specifically in the virion maturation and egress process rather than in viral genome replication or gene expression .

To assess viral DNA replication in BFRF1-mutant contexts, researchers should:

  • Induce the lytic cycle in cells harboring wild-type or BFRF1-KO EBV

  • Perform Gardella gel analysis or quantitative PCR at various time points post-induction

  • Compare viral genome copy numbers between wild-type and mutant virus

What experimental evidence demonstrates BFRF1's role in nuclear egress?

The essential role of BFRF1 in nuclear egress is supported by several experimental findings:

  • Electron microscopy shows accumulation of nucleocapsids in the nucleus of cells infected with BFRF1-KO virus, indicating a block in nuclear export .

  • Binding assays and infection experiments demonstrate significantly reduced viral titers from BFRF1-KO virus compared to wild-type EBV .

  • Complementation experiments where BFRF1 expression is restored in trans result in rescued viral titers, confirming BFRF1's specific role in viral egress .

  • The localization of BFRF1 to the nuclear membrane, particularly in areas where nucleocapsid budding occurs, is consistent with its proposed function in facilitating nuclear egress .

How does BFRF1 suppress host interferon responses?

BFRF1 has been shown to suppress host interferon responses through several mechanisms:

  • BFRF1 significantly inhibits Sendai virus (SeV)-induced IFN-β promoter activity and mRNA expression in a dose-dependent manner .

  • It also suppresses the activation of interferon-stimulated response element (ISRE) promoter, affecting downstream interferon-stimulated genes (ISGs) such as ISG54 .

  • Mechanistically, BFRF1 targets the RIG-I-like receptor (RLR) signaling pathway by interacting with IKKi (IκB kinase-ε) .

  • This interaction blocks the signal transduction between IKKi and IRF3, preventing IRF3 phosphorylation and subsequent activation of the IFN-β promoter .

The inhibitory effect of BFRF1 on the interferon pathway can be assessed using the following methods:

  • Dual-luciferase reporter assays with IFN-β or ISRE promoter reporters

  • RT-qPCR to measure mRNA levels of IFN-β and ISGs

  • Western blotting to detect phosphorylation status of IRF3

  • Co-immunoprecipitation to analyze protein-protein interactions between BFRF1 and components of the IFN signaling pathway

At which level does BFRF1 interfere with the interferon signaling pathway?

This indicates that BFRF1 acts specifically at the level of IKKi, potentially interfering with IRF3 phosphorylation and subsequent activation of the IFN-β promoter. The specific targeting of IKKi by BFRF1 represents a strategic immune evasion mechanism employed by EBV to counteract host antiviral responses.

What are the optimal methods for detecting BFRF1 expression?

For optimal detection of BFRF1 expression, researchers can employ several complementary techniques:

  • Western blotting: Using specific anti-BFRF1 monoclonal antibodies (such as E7) or antibodies against epitope tags (Flag, Myc, HA) for tagged versions. This provides quantitative information about protein expression levels .

  • Immunofluorescence microscopy: This technique reveals the subcellular localization of BFRF1, showing its characteristic nuclear membrane distribution. Counterstaining with markers for nuclear envelope components can provide additional spatial information .

  • RT-qPCR: For mRNA expression analysis, primers targeting the BFRF1 open reading frame can be used. Recommended primer sequences include 5′-GGG TCT CTC AAC GGA TGT TGA and 5′-CTC AAC TCA CGT GTC TAG TGT C .

  • Flow cytometry: For analyzing BFRF1 expression in larger cell populations, particularly when studying the effects of mutations or inhibitors on expression levels.

How can researchers study BFRF1 protein-protein interactions?

Several techniques are effective for studying BFRF1 protein-protein interactions:

  • Co-immunoprecipitation (Co-IP): This is the most widely used method for detecting BFRF1 interactions. Cells are transfected with BFRF1 and potential interacting proteins, followed by immunoprecipitation with specific antibodies. For example, HEK293T cells can be co-transfected with BFRF1-Flag and IKKi-HA expression plasmids, and cell lysates immunoprecipitated with anti-Flag mAb or mouse nonspecific IgG as a control .

  • Pull-down assays: These can be performed using recombinant GST-BFRF1 or His-tagged BFRF1 to identify interacting partners from cell lysates.

  • Proximity ligation assay (PLA): This technique allows visualization of protein-protein interactions in situ, providing spatial information about where in the cell BFRF1 interacts with its partners.

  • Bimolecular fluorescence complementation (BiFC): By fusing complementary fragments of fluorescent proteins to BFRF1 and potential interacting proteins, interactions can be visualized in living cells.

What are the unresolved questions about BFRF1 function?

Despite significant advances in understanding BFRF1, several important questions remain unresolved:

  • Structural determinants of function: While amino acids 80-291 are known to be critical, the specific structural domains and motifs within BFRF1 that mediate its various functions are not fully characterized.

  • Interaction partners during nuclear egress: The complete set of viral and cellular proteins that interact with BFRF1 during the nuclear egress process remains to be identified.

  • Regulation of BFRF1 activity: The mechanisms controlling BFRF1 localization, timing of expression, and activity during the viral life cycle are not completely understood.

  • Role in different cell types: Whether BFRF1 functions identically in different cell types infected by EBV (B cells, epithelial cells) is not clear.

  • Detailed mechanism of IFN suppression: While BFRF1 is known to interact with IKKi, the precise molecular mechanism by which this interaction blocks IRF3 activation requires further investigation.

What emerging methodologies could advance BFRF1 research?

Several emerging technologies hold promise for advancing BFRF1 research:

  • CRISPR-Cas9 genome editing: This can facilitate the creation of more precise EBV mutants and cellular models for studying BFRF1 function.

  • Single-cell analysis techniques: These can reveal cell-to-cell variation in BFRF1 expression and function during viral replication.

  • Cryo-electron microscopy: This technique could provide structural insights into BFRF1's interactions with the nuclear membrane and other proteins.

  • Proteomics approaches: Techniques such as BioID or APEX2 proximity labeling could identify the complete BFRF1 interactome during different stages of viral replication.

  • Advanced imaging techniques: Super-resolution microscopy and live-cell imaging could provide dynamic information about BFRF1's role in nuclear egress.

  • Systems biology approaches: Integration of multi-omics data could reveal broader impacts of BFRF1 on cellular pathways beyond its known functions.

How can researchers optimize BFRF1 complementation assays?

For optimal BFRF1 complementation assays, researchers should consider the following approach:

  • Establish 293 cells carrying the BFRF1-KO EBV genome under hygromycin selection.

  • Confirm the integrity of the BFRF1 locus by Southern blot analysis using a BFRF1-specific probe.

  • Co-transfect these cells with a BZLF1 expression plasmid to induce the lytic cycle, along with varying amounts of a BFRF1 expression plasmid.

  • Collect viral supernatants 72 hours post-transfection and filter through a 0.8-μm-pore-size filter.

  • Quantify viral titers by infecting susceptible cell lines and measuring GFP-positive cells (if using a GFP-tagged EBV) by fluorescence microscopy or flow cytometry.

  • Alternatively, assess viral titers by measuring B lymphocyte immortalization efficiency following infection of cord blood lymphocytes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.