Recombinant Equine arteritis virus Glycoprotein 2b (GP2b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GP2b; 2b; Glycoprotein 2b; Protein GP2b; GP(S
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-227
Protein Length
Full Length of Mature Protein
Species
Equine arteritis virus (strain Bucyrus) (EAV)
Target Names
GP2b
Target Protein Sequence
AWWRGVHEVRVTDLFKDLQCDNLRAKDAFPSLGYALSIGQSRLSYMLQDWLLAAHRKEVM PSNIMPMPGLTPDCFDHLESSSYAPFINAYRQAILSQYPQELQLEAINCKLLAVVAPALY HNYHLANLTGPATWVVPTVGQLHYYASSSIFASSVEVLAAIILLFACIPLVTRVYISFTR LMSPSRRTSSGTLPRRKIL
Uniprot No.

Target Background

Function

Minor envelope protein. Component of the glycoprotein heterotrimer GP2b-GP3-GP4, likely responsible for attachment to the target host cell. This attachment induces virion internalization primarily via clathrin-dependent endocytosis.

Database Links

KEGG: vg:921344

Protein Families
Arteriviridae GP2b protein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein. Secreted.

Q&A

What is the biological significance of GP2b in Equine arteritis virus structure?

GP2b serves as one of the minor envelope glycoproteins in EAV, forming part of a heterotrimeric complex with GP3 and GP4. This complex plays a critical role in the virion architecture and is thought to be involved in the viral entry process. While GP5 and M proteins constitute the basic protein matrix of the viral envelope as major structural proteins, GP2b contributes to the functional integrity of the viral particle through its interactions with other glycoproteins . The GP2b/GP3/GP4 complex is essential for maintaining proper virion structure and functionality, distinguishing it from the more abundant GP5/M heterodimers that form the core envelope framework.

How is the GP2b protein structurally organized and what post-translational modifications does it undergo?

GP2b is a transmembrane glycoprotein that undergoes N-glycosylation as a critical post-translational modification . The mature GP2b protein contains four cysteine residues (positions 48, 102, 137, and 195) that participate in disulfide bond formation. Research has demonstrated that cysteine at position 102 forms an intermolecular disulfide bridge with one of the cysteines in the GP4 protein, while cysteines at positions 48 and 137 establish an intrachain disulfide bond . This specific arrangement of disulfide bridges is essential for proper protein folding and the formation of the GP2b/GP3/GP4 complex. The N-glycosylation pattern of GP2b does not appear to be significantly altered by co-expression with GP3 and GP4, suggesting independent glycosylation processing pathways for each component of the trimer .

What is known about the subcellular localization of GP2b in infected or transfected cells?

GP2b exhibits specific subcellular localization patterns that have been characterized through immunofluorescence studies. When tagged with Myc (GP2-Myc), the protein localizes to the endoplasmic reticulum (ER), cis-Golgi, and ER-Golgi intermediate compartment (ERGIC) . This distribution pattern suggests that GP2b follows the secretory pathway typical of viral envelope proteins. Colocalization studies have shown that GP2b highly colocalizes with the other components of the trimer (GP3 and GP4) and partially colocalizes with the E protein . The specific subcellular distribution of GP2b is important for understanding its processing, assembly into heterotrimeric complexes, and incorporation into viral particles during the viral replication cycle.

What are the optimal expression systems for producing recombinant GP2b protein for experimental studies?

For recombinant GP2b expression, mammalian cell systems have proven most effective due to the requirement for proper post-translational modifications, particularly N-glycosylation and disulfide bond formation. BHK-21 cells have been successfully used with the CAG promoter driving expression . When designing expression constructs, researchers should consider:

  • Tag selection and placement: V5 tags with linker sequences have shown better results than direct FLAG tagging for GP4, which may inform GP2b tagging strategies .

  • Codon optimization: Adapting the viral sequence to the codon usage of the expression host can improve protein yields.

  • Expression verification: Western blotting, immunoprecipitation, and immunofluorescence assays can confirm successful expression and proper localization.

For complex formation studies, co-transfection with plasmids encoding GP3 and GP4 is recommended, as this mimics the natural heterotrimeric assembly process .

What methodological approaches are most effective for studying the interactions between GP2b and other viral proteins?

Multiple complementary techniques provide robust analysis of GP2b interactions with other viral proteins:

TechniqueApplicationKey Considerations
ImmunoprecipitationDetecting protein-protein interactionsUse mild detergents (1% NP-40 or Triton X-100) to preserve complexes; include alkylating agents like IAM (50 mM) to prevent disulfide rearrangement
Western blotting under non-reducing conditionsVisualizing disulfide-linked complexesAvoid reducing agents; use SDS-PAGE with 15% polyacrylamide gels for optimal resolution of heterotrimeric complexes
Immunofluorescence with confocal microscopyCo-localization analysisFixation with 4% paraformaldehyde; quantify co-localization using Pearson's correlation coefficient
Site-directed mutagenesisFunctional analysis of specific residuesTarget cysteine residues (especially positions 48, 102, 137, and 195) to study disulfide bonding patterns

For studying the GP2b/GP3/GP4 complex specifically, researchers should express all three proteins simultaneously and analyze their interactions using non-reducing conditions to preserve disulfide linkages .

How can researchers effectively detect and quantify GP2b in viral particles or cellular extracts?

Detection and quantification of GP2b can be achieved through several complementary approaches:

  • Western blotting: Using GP2b-specific antibodies under both reducing and non-reducing conditions. Under non-reducing conditions, multiple conformations of GP2b with different electrophoretic mobilities can be observed due to various disulfide bonding patterns .

  • Immunoprecipitation: Particularly useful for analyzing complexes containing GP2b. This technique can be combined with metabolic labeling using [35S]methionine to enhance sensitivity .

  • Immunofluorescence: For cellular localization studies, with quantitative co-localization analysis using software such as Huygens Professional .

  • Quantitative RT-PCR: While not directly detecting the protein, real-time TaqMan RT-PCR assays have been developed for EAV that could be modified to quantify GP2b expression at the mRNA level .

For purification of recombinant GP2b, researchers should consider incorporating affinity tags (His, Myc, or V5) separated by linker sequences, which has proven effective based on experimental evidence .

How do specific mutations in GP2b cysteine residues affect protein folding and complex formation?

Cysteine residues in GP2b play critical roles in protein folding and complex formation through specific disulfide bonds. Mutational studies have revealed:

  • Cysteine at position 102 (C102): Mutation to serine (C102S) disrupts the intermolecular disulfide bridge with GP4, preventing the formation of covalent GP2b-GP4 heterodimers . This mutation significantly alters the electrophoretic mobility pattern of GP2b under non-reducing conditions, resulting in only two conformational variants compared to the four observed with wild-type GP2b.

  • Cysteines at positions 48 and 137 (C48, C137): These residues form an intramolecular disulfide bond. Mutation of either cysteine (C48S or C137S) results in proteins that display only two conformational variants under non-reducing conditions, with distinctive electrophoretic mobility patterns .

  • Cysteine at position 195 (C195): Mutation of this residue (C195S) does not significantly alter the four-band pattern observed with wild-type GP2b, suggesting it is not involved in critical disulfide bonding .

These mutations not only affect GP2b folding but also impact the assembly of the GP2b/GP3/GP4 heterotrimeric complex and the incorporation of these proteins into viral particles, ultimately affecting virus infectivity .

What is the role of GP2b in viral entry and how can this function be experimentally assessed?

GP2b, as part of the heterotrimeric complex with GP3 and GP4, is believed to play a crucial role in viral entry, although the exact mechanism remains to be fully elucidated. To experimentally assess this function, researchers can employ several approaches:

  • Virus neutralization assays: Using antibodies specifically targeting GP2b to determine if they can prevent viral infection.

  • Pseudotyped virus systems: Generating viral particles displaying GP2b in conjunction with GP3 and GP4 to study entry mechanisms.

  • Site-directed mutagenesis: Creating GP2b mutants (particularly targeting cysteine residues involved in complex formation) and evaluating their impact on viral entry through infectious cDNA clones .

  • Cell-cell fusion assays: Assessing the ability of GP2b, in combination with other viral proteins, to mediate membrane fusion.

  • Receptor binding studies: Investigating potential interactions between the GP2b/GP3/GP4 complex and cellular receptors.

The available data suggest that the correct association of GP2b with GP3 and GP4 is essential for efficient incorporation into viral particles and for virus infectivity , highlighting the importance of this complex in the viral entry process.

How does the heterotrimeric complex formation between GP2b, GP3, and GP4 contribute to immune evasion or viral pathogenesis?

The GP2b/GP3/GP4 heterotrimeric complex plays significant roles in immune interactions and viral pathogenesis through several mechanisms:

Research approaches to investigate these aspects include developing monoclonal antibodies against specific epitopes of the complex, creating recombinant viruses with mutations in GP2b that disrupt complex formation, and analyzing the impact of these mutations on viral pathogenesis in cell culture and animal models.

How can structural information about GP2b be leveraged for rational vaccine design against Equine arteritis virus?

Structural insights into GP2b and its interactions within the heterotrimeric complex offer valuable opportunities for rational vaccine design:

  • Identification of neutralizing epitopes: The structure of GP2b, particularly regions involved in receptor binding or fusion activity, can guide the selection of immunogenic epitopes for subunit vaccines. The correct disulfide bonding pattern is crucial for maintaining these epitopes in their native conformation .

  • Design of stabilized recombinant proteins: Based on knowledge of critical disulfide bonds (e.g., C48-C137 intramolecular bond and C102 intermolecular link with GP4), researchers can design stabilized recombinant proteins that maintain proper folding and antigenic properties .

  • Heterotrimeric complex presentation: Since GP2b functions as part of a complex with GP3 and GP4, vaccines expressing all three proteins in a conformation that allows proper complex formation may elicit more effective immune responses than those targeting individual proteins .

  • Virus-like particle (VLP) approaches: Incorporating GP2b along with other structural proteins into VLPs can present these antigens in a virion-like context, potentially enhancing immunogenicity while remaining non-infectious.

The approach of using replicon particles expressing major envelope proteins has shown promise in inducing neutralizing antibody responses and protecting horses against challenge with virulent EAV , suggesting that similar strategies incorporating GP2b could be effective.

What is the relationship between GP2b mutations and viral fitness or immune escape in field isolates of EAV?

The relationship between GP2b mutations and viral fitness or immune escape represents an important area of ongoing research:

  • Phylogenetic analyses of field isolates have revealed genetic variation in EAV envelope proteins, including GP2b, which may correlate with differences in virulence or immune evasion .

  • Conservation of cysteine residues: Despite sequence variation, the cysteine residues involved in critical disulfide bonds (positions 48, 102, 137) tend to be highly conserved across isolates, underscoring their structural importance .

  • Selective pressure: Regions of GP2b exposed on the virion surface may be under selective pressure from the host immune response, potentially leading to immune escape variants.

  • Functional constraints: Mutations affecting complex formation with GP3 and GP4 would likely compromise viral fitness, limiting the acceptable mutations in these interaction domains .

To investigate these relationships, researchers can:

  • Conduct comparative genomic analyses of GP2b sequences from various field isolates

  • Associate genetic variations with differences in neutralization sensitivity

  • Use reverse genetics to introduce specific mutations into infectious clones and assess their impact on viral replication and immune evasion

  • Monitor changes in GP2b during persistent infection of stallions, which might reveal adaptive mutations favoring immune escape

How do the interactions between GP2b and cellular components influence viral replication and assembly?

The interactions between GP2b and cellular components significantly impact viral replication and assembly:

  • Subcellular localization: GP2b-Myc localizes to the ER, cis-Golgi, and ERGIC , suggesting interactions with cellular trafficking machinery that direct the protein to sites of viral assembly.

  • Retention signals: The distribution pattern of GP2b indicates specific interactions with cellular retention mechanisms in these compartments, which may be essential for coordinating assembly with other viral components.

  • Glycosylation machinery: GP2b undergoes N-glycosylation through interactions with cellular glycosyltransferases , which affects protein folding, stability, and potentially antigenic properties.

  • Disulfide bond formation: Proper disulfide bond formation in GP2b requires the cellular redox environment and likely involves protein disulfide isomerases in the ER .

  • Interaction with E protein: GP2b partially colocalizes with the E protein , suggesting functional interactions that may influence virion assembly.

Research approaches to further investigate these interactions include:

  • Proximity labeling techniques to identify cellular interaction partners

  • Mutagenesis of potential interaction motifs in GP2b

  • Inhibitor studies targeting specific cellular pathways to assess their impact on GP2b processing and function

  • Live-cell imaging to track the dynamics of GP2b trafficking and interactions during infection

What are the latest advances in understanding the role of GP2b in EAV pathogenesis?

Recent research has provided significant insights into GP2b's role in EAV pathogenesis:

  • Structural characterization: Detailed analysis of disulfide bonding has revealed that cysteine at position 102 of GP2b forms an intermolecular bridge with GP4, while cysteines at positions 48 and 137 form an intramolecular bond . This structural information is crucial for understanding how GP2b contributes to the stability and function of the heterotrimeric complex.

  • Subcellular localization: Studies have shown that GP2b-Myc localizes to the ER, cis-Golgi, and ERGIC, providing insights into its trafficking pathway during viral replication .

  • Complex formation: The GP2b/GP3/GP4 heterotrimeric complex has been confirmed through multiple techniques, highlighting its importance in the viral life cycle .

  • Role in viral entry: The available evidence increasingly supports a critical role for the GP2b/GP3/GP4 complex in viral entry, with proper complex formation being essential for virus infectivity .

These advances have shifted our understanding of EAV pathogenesis from focusing primarily on the major structural proteins (GP5/M) to recognizing the essential contributions of minor glycoproteins like GP2b to viral entry and immune interactions.

What emerging technologies or approaches show promise for studying GP2b function and interactions?

Several emerging technologies hold promise for advancing our understanding of GP2b:

  • Cryo-electron microscopy: This technique could provide high-resolution structural information about GP2b alone and in complex with GP3 and GP4, revealing detailed molecular interactions.

  • CRISPR-Cas9 gene editing: Creating knockout cell lines for potential GP2b interaction partners to identify essential host factors.

  • Single-molecule tracking: Following the movement and interactions of fluorescently labeled GP2b in live cells during infection.

  • Proteomics approaches: Mass spectrometry-based techniques to identify host factors that interact with GP2b during different stages of infection.

  • Advanced glycobiology tools: Methods to precisely characterize the glycan structures on GP2b and how they influence protein function and immunogenicity.

  • Systems biology approaches: Integrating transcriptomic, proteomic, and functional data to build comprehensive models of GP2b's role in the viral life cycle.

  • Computational modeling: Using the existing structural data on disulfide bonding patterns to model the three-dimensional structure of the GP2b/GP3/GP4 complex and predict functional domains.

How might research on GP2b contribute to broader understanding of viral glycoprotein complexes in the Arteriviridae family?

Research on EAV GP2b provides valuable comparative insights for understanding glycoprotein complexes across the Arteriviridae family:

  • Conserved structural features: The disulfide bonding patterns observed in EAV GP2b may represent conserved structural features across arteriviruses, providing a framework for understanding similar proteins in related viruses.

  • Heterotrimeric complex formation: The GP2b/GP3/GP4 complex appears to be a conserved feature in arteriviruses, suggesting functional importance throughout the family .

  • Protein processing and trafficking: Insights into GP2b's subcellular localization and processing may reveal conserved cellular pathways exploited by arteriviruses for glycoprotein maturation.

  • Evolution of entry mechanisms: Comparative studies of GP2b across different arteriviruses could reveal evolutionary adaptations in entry mechanisms and host range determinants.

By establishing patterns of conservation and variation in GP2b structure and function across the Arteriviridae family, researchers can identify both universal principles of arterivirus biology and specific adaptations that contribute to the distinct pathogenic properties of individual viruses. This comparative approach may also reveal potential broad-spectrum antiviral targets within conserved regions of the GP2b protein or its interaction interfaces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.