Recombinant Equine arteritis virus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; 6; Membrane protein; Protein M
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Equine arteritis virus (strain Bucyrus) (EAV)
Target Names
M
Target Protein Sequence
MGAIDSFCGDGILGEYLDYFILSVPLLLLLTRYVASGLVYVLTALFYSFVLAAYIWFVIV GRAFSTAYAFVLLAAFLLLVMRMIVGMMPRLRSIFNHRQLVVADFVDTPSGPVPIPRSTT QVVVRGNGYTAVGNKLVDGVKTITSAGRLFSKRTAATAYKLQ
Uniprot No.

Target Background

Function

Major envelope protein.

Database Links

KEGG: vg:921340

Protein Families
Arteriviridae membrane protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host membrane; Multi-pass membrane protein.

Q&A

What is the Equine Arteritis Virus M protein and what is its significance?

The M protein is one of the three major structural proteins of Equine Arteritis Virus (EAV), which belongs to the family Arteriviridae. EAV is the causative agent of Equine Viral Arteritis (EVA), a contagious viral disease affecting equids worldwide . The M protein plays a crucial role in viral structure and appears to be the major target of the equine antibody response to EAV infection, making it significant for both viral pathogenesis and immunity studies . The protein is encoded by Open Reading Frame 6 (ORF6) of the EAV genome, and its expression in recombinant systems has been valuable for understanding EAV biology and developing diagnostic tools .

What expression systems are commonly used for producing recombinant EAV M protein?

Several expression systems have been successfully employed for the production of recombinant EAV M protein. The baculovirus expression system has proven effective for expressing functional M protein, as demonstrated in studies developing ELISAs for EAV antibody detection . Additionally, the Venezuelan Equine Encephalitis (VEE) replicon vector system has been used to express the M protein both individually and in heterodimer form with the GL protein . These systems allow for proper post-translational modifications necessary for maintaining the native conformation and immunological properties of the M protein. Both systems have specific advantages depending on the research objectives, with baculovirus systems often preferred for high-yield protein production and VEE replicon systems valuable for immunogenicity studies.

How do you verify the authenticity of recombinant EAV M protein after expression?

Verification of recombinant EAV M protein authenticity typically involves multiple complementary approaches. Immunochemical methods utilizing M protein-specific monoclonal or polyclonal antibodies in Western blot or immunofluorescence assays confirm protein identity . Size verification through SDS-PAGE and mass spectrometry ensures the correct molecular weight. For functional verification, researchers can assess the ability of the recombinant protein to be recognized by antibodies from EAV-infected horses using indirect ELISAs . Additionally, when expressed alongside the GL protein, the formation of GL/M heterodimers can be analyzed through co-immunoprecipitation assays, which provides evidence of proper protein folding and interactions .

What is the significance of the interaction between EAV M protein and GL protein in recombinant expression systems?

The interaction between M and GL proteins has profound implications for protein conformation and immunogenicity. Research has demonstrated that authentic posttranslational modification and conformational maturation of the recombinant GL protein occur only in the presence of the M protein . This interaction is necessary for the induction of neutralizing antibodies, as studies in BALB/c mice showed that only animals inoculated with replicon particles expressing the GL/M heterodimer developed neutralizing antibodies against EAV . This finding highlights a critical consideration for researchers: when designing recombinant expression constructs for vaccine development or serological diagnostics, co-expression of M and GL proteins may be necessary to generate immunologically relevant structures. The GL/M heterodimer appears to present conformational epitopes that are essential for eliciting a protective immune response but are absent when either protein is expressed alone.

How does the M protein contribute to the sensitivity and specificity of EAV serological diagnostic assays?

Interestingly, the ELISA using this protein cocktail could not reliably detect antibodies in sera from vaccinated horses, suggesting differences in the antibody profiles between natural infection and vaccination . This has important implications for distinguishing between infected and vaccinated animals (DIVA) in serological surveillance programs. Researchers designing diagnostic assays should consider these findings when selecting antigens for optimal test performance.

Why do carrier stallions show different antibody responses to EAV M and N proteins compared to non-carrier seropositive horses?

One intriguing finding in EAV research is the differential antibody response observed in carrier stallions compared to non-carrier seropositive horses. All sera from carrier stallions evaluated in research showed obvious reactivity with the N protein, whereas seropositive non-carrier stallions, mares, and geldings did not respond consistently to the N protein . This distinction may reflect differences in viral replication dynamics and protein expression during persistent infection versus cleared infection. The persistent infection established in carrier stallions likely leads to continuous or intermittent expression of viral proteins, potentially altering the immunodominance patterns in the antibody response. This phenomenon could potentially be exploited for developing diagnostic assays that specifically identify carrier stallions, which represent a significant epidemiological concern as they can shed virus for extended periods, sometimes for life . A comprehensive understanding of this differential antibody response requires further research but offers promising avenues for targeted diagnostic development.

What are the optimal conditions for expressing functional recombinant EAV M protein in the baculovirus system?

For optimal expression of functional recombinant EAV M protein using the baculovirus system, several methodological considerations are crucial. The process typically begins with precise cloning of the M protein gene (ORF6) into a baculovirus transfer vector, ensuring the correct reading frame and the addition of appropriate tags for purification if needed . The baculovirus expression system using insect cells (typically Sf9 or High Five cells) provides eukaryotic post-translational modifications necessary for proper protein folding. Researchers should optimize infection parameters including multiplicity of infection (MOI), harvesting time post-infection (typically 48-72 hours), and culture conditions (temperature, media composition).

For purification, a combination of methods is recommended depending on the protein tags used:

Purification StepMethodConditionsNotes
Initial CaptureAffinity ChromatographyBased on tag (His, GST, etc.)Preserves native conformation
IntermediateIon Exchange ChromatographypH and salt gradient optimizationRemoves contaminants
FinalSize Exclusion ChromatographyIsotonic buffersEnsures homogeneity

Validation of proper expression should include Western blotting with EAV-specific antibodies and functional assays to verify antigenicity with reference sera .

How can researchers distinguish between neutralizing and non-neutralizing epitopes on the recombinant EAV M protein?

Distinguishing between neutralizing and non-neutralizing epitopes on the EAV M protein is a complex methodological challenge. Research indicates that while the M protein alone can induce antibodies in experimental animals, these antibodies are often non-neutralizing when the M protein is expressed independently . Neutralizing epitopes appear to be conformational and dependent on the interaction between M and GL proteins in heterodimer form .

To identify and distinguish these epitopes, researchers can employ several complementary approaches:

  • Epitope mapping using peptide arrays or phage display libraries to identify linear epitopes recognized by antibodies from infected horses

  • Competition assays between monoclonal antibodies with known neutralizing activity and test antibodies

  • Site-directed mutagenesis of specific regions of the M protein to identify residues critical for neutralization

  • Cryo-electron microscopy or X-ray crystallography of the GL/M heterodimer to determine structural conformations that correlate with neutralization

Crucially, the expression system chosen for these studies should maintain the native conformation of the M protein, preferably in association with the GL protein, as the VEE replicon system has demonstrated . Additionally, researchers should employ both naturally infected and experimentally infected/vaccinated horse sera in these analyses to capture the full range of potential antibody responses.

What protocols are most effective for evaluating the immunogenicity of recombinant EAV M protein formulations?

Evaluating the immunogenicity of recombinant EAV M protein formulations requires robust protocols that assess both humoral and cellular immune responses. Based on available research methodologies, the following approach is recommended:

For animal studies, BALB/c mice have been successfully used as a preliminary model before equine studies . Horses, as the natural host, provide the most relevant immunological data. The immunization protocol should include:

PhaseTimingProceduresAnalysis
Pre-immunizationDay 0Collect baseline serumStore for serological comparison
Primary immunizationDay 0Administer test formulationDocument any adverse reactions
BoostDay 21-28Administer second doseMonitor for enhanced responses
Serum collectionMultiple timepoints (days 14, 28, 42, 56)Collect serum samplesTrack antibody development kinetics

For comprehensive immunogenicity assessment, multiple assays should be performed:

  • ELISA assays using purified M protein to quantify specific antibody titers

  • Virus neutralization tests to determine functional antibody responses

  • Western blotting to analyze specificity of antibodies

  • ELISpot or flow cytometry-based assays to evaluate T-cell responses

Importantly, research shows that when evaluating M protein immunogenicity, parallel testing with GL protein and the GL/M heterodimer is essential for proper interpretation, as the heterodimer appears to present the conformational epitopes necessary for neutralizing antibody induction .

What are the challenges in developing a DIVA (Differentiating Infected from Vaccinated Animals) test based on recombinant EAV M protein?

Developing a DIVA test based on recombinant EAV M protein faces several significant challenges. Research has shown that ELISAs utilizing a cocktail of EAV structural proteins (including M protein) could detect antibodies in horses following natural or experimental infection but not reliably in vaccinated horses . While this suggests potential for DIVA capabilities, several obstacles remain:

  • Identifying specific epitopes on the M protein that are differentially recognized after infection versus vaccination

  • Determining if the differential response is consistent across diverse field strains of EAV

  • Establishing whether the difference in antibody profiles persists long-term

  • Validating the assay across different horse populations and breeds

How might conformational changes in recombinant EAV M protein affect experimental outcomes?

Conformational changes in recombinant EAV M protein can significantly impact experimental outcomes across multiple research applications. Research has clearly demonstrated that the biologically relevant conformation of the M protein depends on its interaction with the GL protein, as evidenced by the fact that only the GL/M heterodimer induced neutralizing antibodies in experimental studies . This finding has profound implications for researchers working with this protein.

Potential experimental impacts include:

To address these challenges, researchers should:

  • Express the M protein alongside the GL protein when possible

  • Verify proper protein folding using conformation-sensitive techniques

  • Include appropriate controls with known conformation in all experiments

  • Consider native viral particles as reference standards

The expression system chosen can significantly influence protein conformation, with mammalian and insect cell systems generally providing more authentic post-translational modifications than bacterial systems. Additionally, purification methods should be selected to minimize conformational disruption, potentially utilizing mild detergents and avoiding harsh elution conditions for affinity chromatography.

What recent advances have been made in understanding the role of post-translational modifications of EAV M protein?

Recent research has highlighted the critical importance of post-translational modifications (PTMs) for the proper functioning of the EAV M protein. Studies demonstrate that authentic posttranslational modification of the GL protein occurs only in the presence of the M protein, suggesting an interdependent relationship between these proteins during viral maturation . This finding indicates that the M protein either facilitates PTMs of GL or stabilizes conformations necessary for these modifications.

Key aspects of PTMs relevant to EAV M protein research include:

  • Glycosylation patterns: Critical for proper folding and antigenicity

  • Disulfide bond formation: Essential for stabilizing tertiary structure

  • Proteolytic processing: May influence final protein conformation

Researchers studying recombinant EAV M protein should select expression systems that support these necessary modifications. The baculovirus expression system has demonstrated capability in producing M protein with appropriate antigenic properties , while the VEE replicon system has successfully produced M protein that forms functional heterodimers with GL .

Future research directions may include comprehensive characterization of specific PTMs on the M protein using techniques such as mass spectrometry, site-directed mutagenesis of putative modification sites, and correlation studies between specific PTMs and functional outcomes in diagnostic and vaccine applications.

What are the key considerations for researchers working with recombinant EAV M protein?

Researchers working with recombinant EAV M protein should consider several critical factors to ensure successful experimental outcomes. First, the choice of expression system significantly impacts protein functionality - baculovirus and VEE replicon systems have demonstrated success in producing authentic M protein . Second, the M protein's interaction with the GL protein is essential for proper conformation and immunogenicity, with the GL/M heterodimer being necessary for inducing neutralizing antibodies . Therefore, co-expression strategies should be considered for many applications.

For diagnostic applications, while the M protein is a major target of the equine antibody response, using it in combination with other EAV structural proteins (N and GL) provides superior sensitivity and specificity . Researchers should also be aware of differential antibody responses between carrier stallions and other seropositive horses, which may have implications for test interpretation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.