Recombinant Equine herpesvirus 1 Envelope glycoprotein D (gD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gD; GP17/18; 72; Envelope glycoprotein D; gD; Glycoprotein 17/18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-452
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)
Target Names
gD
Target Protein Sequence
TQKLSLGLYNQWWRVCRSVPPPWYVFFNKRSMSTFKLMMDGRLVFAMAIAILSVVLSCGT CEKAKRAVRGRQDRPKEFPPPRYNYTILTRYNATALASPFINDQVKNVDLRIVTATRPCE MIALIAKTNIDSILKELAAAQKTYSARLTWFKIMPTCATPIHDVSYMKCNPKLSFAMCDE RSDILWQASLITMAAETDDELGLVLAAPAHSASGLYRRVIEIDGRRIYTDFSVTIPSERC PIAFEQNFGNPDRCKTPEQYSRGEVFTRRFLGEFNFPQGEHMTWLKFWFVYDGGNLPVQF YEAQAFARPVPPDNHPGFDSVESEITQNKTDPKPGQADPKPNQPFKWPSIKHLAPRLDEV DEVIEPVTKPPKTSKSNSTFVGISVGLGIAGLVLVGVILYVCLRRKKELKKSAQNGLTRL RSTFKDVKYTQLP
Uniprot No.

Target Background

Function

Envelope glycoprotein that binds to host cell entry receptors. It may trigger membrane fusion with the host cell by recruiting the fusion machinery composed of gB and gH/gL.

Protein Families
Herpesviridae glycoprotein D family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the molecular structure of EHV-1 glycoprotein D and how does it compare to other herpesvirus gD proteins?

EHV-1 glycoprotein D (gD1) consists of 402 amino acids, including a 35 amino acid signal peptide and a 23 amino acid transmembrane domain that anchors the molecule into viral and cellular membranes. The protein contains four N-glycosylation sites within its extracellular domain . EHV-1 gD shares 77% amino acid identity with its EHV-4 counterpart (gD4), with the highest density of consecutive non-identical amino acids mapping close to the signal sequence at the amino termini . The longest stretch of consecutive identical amino acids between gD1 and gD4 is located in the extracellular domain near the transmembrane region, ranging from aspartic acid 261 (D261) to threonine 299 (T299) .

What is the functional significance of EHV-1 gD in viral pathogenesis?

EHV-1 glycoprotein D is essential for virus infectivity and serves as the receptor-binding protein that mediates virus entry into host cells . Research has demonstrated that gD1 drastically affects, if not determines, both the host range and clinical severity of EHV infections . When the original gD1 in EHV-1 was deleted and replaced by EHV-4 gD (gD4), the virus lost its broad host range and its ability to cause neurological disease in horses . This indicates that gD1 is a critical determinant of EHV-1's ability to cause equine herpesvirus myeloencephalopathy (EHM), distinguishing it from the less clinically significant EHV-4 .

What specific domains within EHV-1 gD are critical for its biological function?

Research has identified an RSD motif in EHV-1 gD that is critical for viral entry via endocytosis . This motif interacts with cellular integrins, particularly those recognizing RGD motifs such as αVβ5, which are important during the early steps of EHV-1 entry via endocytosis in certain cell types . The N-terminal region of gD1 contains type-specific epitopes that may be important for eliciting protective immunity against EHV-1 . Studies using truncated fragments of gD1 (such as gD1_83, comprising the first 83 amino acids) have helped identify regions that bind type-specific antibodies .

What expression systems have been successfully used for producing recombinant EHV-1 gD?

Multiple expression systems have been employed to produce recombinant EHV-1 gD for research and potential vaccine applications. Escherichia coli (E. coli) has been successfully used to express truncated EHV-1 gD (gDt) with a C-terminal hexahistidine tag using pET vector systems . Insect cells have also been utilized for expressing gD through recombinant baculovirus systems (Bac gD) . Both expression systems produce immunogenic forms of the protein, though they differ in post-translational modifications. Commercially available recombinant EHV-1 gD includes fragments such as amino acids 20-442 expressed in E. coli with either a His-tag or in tag-free form .

How does glycosylation status affect the functionality of recombinant EHV-1 gD?

The glycosylation status of recombinant EHV-1 gD varies depending on the expression system used, which may impact its immunogenicity and functionality. Native EHV-1 gD contains four N-glycosylation sites in its extracellular domain . When expressed in E. coli, the protein lacks glycosylation due to the prokaryotic nature of the expression system. Despite this lack of glycosylation, E. coli-expressed gD has been shown to elicit EHV-1 gD-specific antibodies, including virus-neutralizing antibodies in horses . Comparative studies in mice demonstrated that E. coli-expressed gDt elicited similar levels of gD-specific antibody and neutralizing antibody compared with baculovirus-expressed gD (Bac gD), which contains eukaryotic glycosylation patterns . This suggests that despite the lack of glycosylation, E. coli may be a useful vehicle for large-scale production of EHV-1 gD for vaccine studies .

How can we distinguish between type-specific and cross-reactive antibody responses to EHV-1 gD?

Distinguishing between type-specific and cross-reactive antibody responses to EHV-1 gD requires the identification of type-specific epitopes within the protein. While a diagnostic ELISA to discriminate between EHV-1 and EHV-4 infections is available based on type-specific fragments of glycoprotein G (gG1 and gG4, respectively), the type-specific antibody reaction against gD1 has not yet been sufficiently addressed . Research using luciferase immunoprecipitation system (LIPS) assays with various fragments of gD1 has shown that the N-terminal region, particularly the first 83 amino acids (gD1_83), contains type-specific epitopes . By using truncated fragments of gD1 as antigens in assays, researchers can detect antibodies that specifically recognize EHV-1 but not EHV-4 . This approach allows for the differentiation between horses that have been exposed to or vaccinated against EHV-1 versus those that have only been exposed to EHV-4.

What experimental models are available for studying EHV-1 gD function and immunogenicity?

Several experimental models have been established for studying EHV-1 gD function and immunogenicity:

  • Cell culture models: Various cell lines, including Chinese hamster ovary (CHO-K1) cells, have been used to study EHV-1 entry mechanisms mediated by gD . These systems allow for the investigation of receptor interactions and entry pathways.

  • Mouse models: BALB/c mice have been used as a model of EHV-1 respiratory infection to evaluate the immunogenicity and protective efficacy of recombinant gD . In this model, mice are immunized with recombinant gD and then challenged with EHV-1 to assess protection.

  • Equine models: Horses represent the natural host for EHV-1 and provide the most relevant model for studying immune responses against gD . Studies in horses have evaluated antibody responses to various fragments of gD1 and the protective efficacy of gD-based vaccines.

  • Ex vivo models: Isolated peripheral blood mononuclear cells (PBMC) and equine endothelial cells (EC) have been used to study cell type-specific entry pathways of EHV-1, revealing that the virus enters PBMC predominantly via the endocytic pathway, whereas in EC, entry occurs mainly via fusion at the plasma membrane .

What methodologies are most effective for assessing the immunogenicity of recombinant EHV-1 gD?

Several methodologies have proven effective for assessing the immunogenicity of recombinant EHV-1 gD:

  • LIPS (Luciferase Immunoprecipitation System) assays: This technique has been successfully employed to detect antibodies against various fragments of gD1 in horse sera . LIPS assays provide high sensitivity and specificity for detecting antibody responses.

  • Virus neutralization assays: These assays measure the ability of antibodies to neutralize EHV-1 infectivity in cell culture, providing a functional assessment of antibody responses .

  • Western blot analysis: This technique has been used to characterize recombinant gD expression, showing distinct protein bands corresponding to different forms of the protein . For E. coli-expressed gDt with a C-terminal hexahistidine tag, Western blot analysis using an anti-gD monoclonal antibody demonstrated the presence of gDt bands at 37.5, 36, 29.5, and 28 kDa .

  • Functional ELISA: The biological activity of recombinant EHV-1 gD can be determined by its binding ability in a functional ELISA . This approach assesses the proper folding and functional integrity of the recombinant protein.

  • Prime-boost vaccination protocols: Combining DNA vaccination with protein boosting has been evaluated for enhancing immune responses against gD . This approach allows for the assessment of different vaccination strategies.

How does the RSD motif in EHV-1 gD influence viral entry mechanisms and cell tropism?

The RSD motif in EHV-1 gD plays a critical role in viral entry via endocytosis by interacting with cellular integrins, particularly those recognizing RGD motifs such as αVβ5 . Mutational analysis has revealed that this motif is essential for entry via the endocytic pathway in certain cell types . EHV-1 exhibits differential entry mechanisms depending on the target cell type, entering peripheral blood mononuclear cells (PBMC) predominantly via the endocytic pathway, whereas in equine endothelial cells (EC), entry occurs mainly via fusion at the plasma membrane . This differential entry mechanism may contribute to the broad tissue tropism of EHV-1 and its ability to infect multiple cell types during the course of infection. The interaction between the RSD motif in gD and cellular integrins appears to trigger endocytosis, leading to internalization of the virus and subsequent infection . Understanding this mechanism may provide insights into how EHV-1 spreads within the host and causes various clinical manifestations, including respiratory disease, abortion, and neurological disorders.

What strategies can be employed to design more effective EHV-1 vaccines based on recombinant gD?

Based on current research findings, several strategies could enhance the effectiveness of EHV-1 vaccines incorporating recombinant gD:

  • Focus on type-specific epitopes: Research suggests that type-specific antibodies against gD1, rather than cross-reactive antibodies common to EHV-1 and EHV-4, may be more important for protection against EHM . Future vaccine developments should favor type-specific antigens while avoiding type-common antigens .

  • N-terminal targeting: The N-terminal region of gD1 contains a higher density of type-specific epitopes . Vaccine formulations could focus on these regions to elicit more specific immune responses.

  • Combined DNA and protein immunization: Studies have investigated prime-boost protocols using gD DNA followed by recombinant gD protein boosting . This approach may enhance both humoral and cell-mediated immune responses.

  • Production system selection: Despite the lack of glycosylation, E. coli-expressed gD has been shown to elicit virus-neutralizing antibodies in horses, suggesting that E. coli may be a useful vehicle for large-scale production of EHV-1 gD for vaccine studies . The choice of expression system should balance immunogenicity, yield, and cost-effectiveness.

  • Targeted delivery systems: Developing delivery systems that can effectively present gD to the immune system, such as adjuvanted formulations or viral vectors, may enhance vaccine efficacy.

What are the implications of EHV-1 gD research for understanding other herpesvirus infections and developing cross-protective vaccines?

Research on EHV-1 gD has broader implications for understanding herpesvirus biology and developing vaccines against related pathogens:

  • Comparative virology: The finding that replacement of gD1 with gD4 affects host range and disease manifestation provides insights into how closely related herpesviruses can cause different clinical syndromes . This may inform studies of other herpesvirus pairs with similar relationships.

  • Entry mechanism diversity: The discovery that EHV-1 can enter cells via different pathways depending on cell type (endocytosis in PBMC vs. fusion at the plasma membrane in EC) highlights the complexity of herpesvirus entry mechanisms . This may be relevant for understanding the pathogenesis of other herpesviruses.

  • Receptor interactions: The interaction between the RSD motif in EHV-1 gD and cellular integrins reveals a novel mechanism of herpesvirus-host interaction . Similar motifs may exist in other herpesvirus glycoproteins and could be targets for antiviral interventions.

  • Vaccine development principles: The observation that type-specific antibodies against gD1, rather than cross-reactive antibodies, may be more important for protection against EHM suggests that future herpesvirus vaccines should focus on type-specific antigens . This principle may apply to other herpesvirus vaccines.

  • Expression system optimization: The finding that non-glycosylated, E. coli-expressed gD can elicit neutralizing antibodies challenges the assumption that glycosylation is essential for immunogenicity . This may influence the choice of expression systems for other herpesvirus glycoprotein vaccines.

What are the optimal conditions for purifying recombinant EHV-1 gD from different expression systems?

Recombinant EHV-1 gD can be purified from E. coli expression systems with high purity (>90%) as determined by SDS-PAGE . For His-tagged constructs, purification typically involves immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins. Commercially available recombinant EHV-1 gD expressed in E. coli (strain Kentucky A, fragment 20-442 aa) is available with either a His-tag or in tag-free form . The purification protocol would differ depending on the presence or absence of the tag. For tag-free versions, alternative chromatography methods such as ion-exchange or size-exclusion would be necessary. When expressed in insect cells using baculovirus systems, recombinant gD may require different purification approaches to account for glycosylation and other post-translational modifications. In all cases, the biological activity of the purified protein can be determined by its binding ability in a functional ELISA , ensuring that the purification process preserves the functional integrity of the protein.

How can researchers validate the structural integrity and functionality of purified recombinant EHV-1 gD?

Validation of recombinant EHV-1 gD's structural integrity and functionality can be accomplished through several complementary approaches:

  • SDS-PAGE and Western blotting: These techniques can confirm the correct molecular weight and immunoreactivity of the purified protein . For E. coli-expressed gDt with a C-terminal hexahistidine tag, Western blot analysis using an anti-gD monoclonal antibody typically shows characteristic bands at 37.5, 36, 29.5, and 28 kDa .

  • Functional ELISA: This assay determines the binding ability of recombinant gD to specific antibodies or receptors, confirming that the protein retains its functional conformation .

  • Virus neutralization assays: Testing whether antibodies generated against the recombinant protein can neutralize EHV-1 infectivity provides functional validation .

  • Receptor binding assays: Assessing the ability of recombinant gD to bind to cellular receptors, such as integrins, can confirm its biological activity .

  • Circular dichroism or other spectroscopic methods: These techniques can provide information about the secondary structure of the protein, ensuring proper folding.

  • Mass spectrometry: This can confirm the identity of the protein and detect any post-translational modifications or degradation products.

Through these complementary approaches, researchers can ensure that purified recombinant EHV-1 gD maintains its structural and functional properties, making it suitable for downstream applications such as immunological studies, vaccine development, or structural biology investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.