Recombinant Equine herpesvirus 1 Envelope glycoprotein E (gE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gE; 74; Envelope glycoprotein E; gE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-550
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)
Target Names
gE
Target Protein Sequence
VQQVELSEGAWAMIDGRDVLTPTNTTTRVTKAWTFLETPPGCAGDISVKKVCVSHSLCED NIIIGKHCNLLTGEHGIALAEFNVVNGSLRRTDDVYFVNGTVFPILAETRSVLQIHRATP SIAGVYTLHVSIDGMMKHSVVLLTVKKPPKQPQPRLRVKTPPPVTVPQVPVKTHTDFVVH GYHSRVYADGESFELSVNLESHIVEPSFSAEIQWYYMNTSSSSCDLFRVFETCIFHPTAM ACLHPEQHTCSFTSPIRATKILHRVYGNCSDHGNSWPSRCHSTLLGNRLYFIQPAQNRVD LLFKDTPASATGLYVFVLLYNGHPEAWTYTLLSTANHFMNVLTDVTRPRLGEHFYTDLGH KIITPHPSVATTEELGAWTRHYLAFLLVIICTCAALLVALVVWGCILYIRSNRKPYEVLN PFETVYTSVPSNDPSDEVLVFERLASDSDDSFDSDSDEELEYPPPPKPAPQLPPYQFVDG GDAPSGRSGFKVWFRDTPEASPVPLHKPTLQGPDYSRVASKLKSILK
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is crucial for cell-to-cell viral spread. It facilitates the sorting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional cellular receptors. This is implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for anterograde infection spread throughout the nervous system. In conjunction with US9, the gE/gI heterodimer plays a role in sorting and transporting viral structural components to axon terminals.

Database Links

KEGG: vg:2948576

Protein Families
Alphaherpesvirinae glycoprotein E family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass membrane protein. Host endosome membrane; Single-pass membrane protein.

Q&A

FAQs for Researchers on Recombinant Equine Herpesvirus 1 Envelope Glycoprotein E (gE)

Advanced Research Questions

  • How do researchers design experiments to isolate the role of gE in EHV-1 virulence?
    A standard approach involves:

    • Mutant Construction: Delete gE/gI genes via homologous recombination .

    • Comparative Analysis:

      • In vitro: Plaque assays (smaller plaques indicate impaired cell-to-cell spread) , one-step growth curves (similar yields suggest intact replication) .

      • In vivo: Intranasal inoculation in horses; gE/gI-deleted mutants cause no clinical signs, while revertants induce fever, nasal discharge, and lymphadenopathy .

    Example Data:

    ParametergE/gI Deletion MutantParent/Revertant Virus
    Plaque Size (FHK)50-60% smaller Normal
    Viral YieldNo significant difference No significant difference
    Equine SymptomsNone Pyrexia, nasal discharge
  • How can conflicting data on gE’s role in viral entry vs. spread be resolved?
    Contradictions arise when studies report intact replication kinetics despite reduced cell-to-cell spread. Methodological considerations:

    • Plaque Assays: Measure spread efficiency (e.g., mutant plaques are smaller due to impaired lateral transmission) .

    • One-Step Growth Curves: Compare intracellular/extracellular titers over time; similar yields indicate gE/gI are dispensable for maturation/release .

    • Neutralization Assays: Use soluble gD/gE to block entry, confirming gE’s role is secondary to gD in receptor binding .

  • What structural or interaction studies exist for gE in EHV-1?
    While gE’s structure is not explicitly detailed in the provided sources, functional inferences are drawn from related herpesviruses:

    • gE-gI Complex: Mediates basolateral sorting in polarized cells and neuronal spread .

    • Receptor Interaction: Likely interacts with host adhesion molecules at cell junctions, analogous to HSV-1 gE/gI .

    • Experimental Tools: Recombinant gE/gI proteins can block cell-cell spread in plaque reduction assays .

Methodological Challenges and Solutions

  • How to evaluate gE’s immunogenicity in vaccine development?

    • Animal Models: Mice inoculated with recombinant gD develop cross-neutralizing antibodies ; similar approaches could test gE.

    • Limitations: gE/gI-deleted mutants provide only partial protection in horses, suggesting adjuvant or multivalent strategies are needed .

  • What genomic sequencing approaches identify gE variations linked to pathogenicity?

    • Comparative Genomics: KyA (attenuated) vs. RacL11 (virulent) strains reveal gE/gI deletions correlate with avirulence .

    • Point Mutations: Single amino acid changes in other genes (e.g., DNA polymerase) may synergize with gE/gI for neuropathogenicity .

Key Research Takeaways:

  • gE/gI Deletion: Abolishes cell-to-cell spread and virulence but retains replication capacity .

  • Therapeutic Targeting: Soluble gE/gI proteins or antibodies could inhibit spread in early infection .

  • Knowledge Gaps: Structural details of gE and its precise host interactions remain underexplored .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.