Recombinant Equine herpesvirus 1 Envelope glycoprotein G (gG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
gG; 70; Envelope glycoprotein G; gG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-411
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)
Target Names
gG
Target Protein Sequence
RLAPDELCYAEPRRTGSPPNTQPERPPVIFEPPTIAIKAESKGCELILLDPPIDVSYRRE DKVNASIAWFFDFGACRMPIAYREYYGCIGNAVPSPETCDAYSFTLIRTEGIVEFTIVNM SLLFQPGIYDSGNFIYSVLLDYHIFTGRVTLEVEKDTNYPCGMIHGLTAYGNINVDETMD NASPHPRAVGCFPEPIDNEAWANVTFTELGIPDPNSFLDDEGDYPNISDCHSWESYTYPN TLRQATGPQTLLVGAVGLRILAQAWKFVGDETYDTIRAEAKNLETHVPSSAAESSLENQS TQEESNSPEVAHLRSVNSDDSTHTGGASNGIQDCDSQLKTVYACLALIGLGTCAMIGLIV YICVLRSKLSSRNFSRAQNVKHRNYQRLEYVA
Uniprot No.

Target Background

Function

A chemokine-binding protein that inhibits neutrophil chemotaxis.

Database Links

KEGG: vg:2948582

Protein Families
Alphaherpesvirinae glycoprotein G family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the primary function of EHV-1 glycoprotein G in viral pathogenesis?

EHV-1 glycoprotein G (gG) functions as a viral chemokine-binding protein (vCKBP) that can bind to a broad range of chemokines, including murine CCL3. This binding ability allows EHV-1 to interfere with proper chemokine function during infection. Specifically, gG inhibits IL-8-induced chemotaxis of equine neutrophils, reducing immune cell migration to infection sites. In vivo analyses have demonstrated that neutrophil migration in target organs such as the lungs is significantly reduced in the presence of gG, contributing directly to viral pathogenesis and virulence . This immunomodulatory activity represents a sophisticated viral strategy to evade host immune responses during infection.

How does EHV-1 gG differ structurally and functionally from EHV-4 gG?

While EHV-1 and EHV-4 are closely related alphaherpesviruses, their respective gG proteins exhibit significant differences. EHV-4 gG shows characteristics of an envelope glycoprotein but possesses type-specific properties not shared with EHV-1 gG. When expressed in bacterial systems, EHV-4 gG reacts exclusively with monospecific sera from horses immunized or infected with EHV-4, but not with sera from horses exposed to EHV-1 . Functionally, supernatants from cells infected with EHV-1 expressing EHV-4 gG (vOH-gG4) were unable to interfere with neutrophil chemotaxis, unlike wild-type EHV-1 gG. This indicates fundamental differences in their immunomodulatory capacities . Interestingly, the hypervariable region alone is not solely responsible for the immunomodulatory potential of EHV-1 gG, suggesting complex structural determinants of function .

What are the different molecular forms of EHV-1 gG identified in infected cells?

Similar to EHV-4, EHV-1 produces multiple species of gG during infection. Research has identified three distinct forms of gG: a full-length virion-associated species (gGVL), a smaller virion-associated species (gGVS), and a secreted species (gGS). The gGS and gGVS appear to be proteolytic cleavage products of gGVL, corresponding to the N- and C-terminal regions, respectively. Western blot analyses conducted under non-reducing conditions have established that gGS is secreted as a 120 kDa glycoprotein, while the virion-associated species exist as 140 and 20 kDa proteins in the virion . Pulse-chase experiments have demonstrated that gGVL rapidly assembles as a homodimer prior to both carbohydrate side-chain maturation in the Golgi and proteolytic cleavage, which occurs during or immediately after passage through the Golgi .

How can recombinant EHV-1 gG be produced for research applications?

To produce recombinant EHV-1 gG, researchers typically employ bacterial or mammalian expression systems. For bacterial expression, the gG gene can be cloned into appropriate expression vectors (such as pET series vectors) with His-tags for purification purposes. For mammalian expression, which better preserves glycosylation patterns, researchers can use various cell lines such as RK13 (rabbit kidney cells) which are permissive for EHV-1 infection .

For recombinant virus construction, a standard approach involves:

  • Constructing plasmids containing the gG gene with desired modifications flanked by viral sequences

  • Co-transfecting these plasmids with viral DNA into permissive cells (e.g., RK13 cells)

  • Isolating and plaque-purifying recombinant viruses

This methodology has been successfully employed to generate various EHV-1 recombinants, including those with modified gG genes . For instance, in studies examining gG function, recombinant viruses were obtained by cotransfections of HΔgp2 DNA and recombinant plasmids into RK13 cells, followed by isolation of non-fluorescing virus plaques and subsequent plaque purification to homogeneity .

What chemotaxis assays can be used to evaluate the functional activity of recombinant EHV-1 gG?

The chemotaxis-inhibiting activity of EHV-1 gG can be evaluated using Transwell migration assays. A standard protocol utilizes 12-well Costar Transwell plates with polycarbonate membranes (3-μm pore size for neutrophils, 5-μm for macrophages) . The methodology involves:

  • Preincubating recombinant chemokines (e.g., 10 ng/ml of CCL3) with recombinant EHV-1 gG (0.3 μg/ml) for 30 minutes at 37°C

  • Applying this mixture to the lower chambers of Transwell plates

  • Adding a cell suspension containing 1×10⁴ neutrophils or macrophages to the upper chamber

  • Incubating for 45 minutes (neutrophils) or 2 hours (macrophages) at 37°C

  • Quantifying migrated cells by staining and counting under a light microscope

  • Expressing results as percent chemotaxis based on the number of input cells

Control conditions should include recombinant chemokine alone (positive control) and medium alone (negative control). This assay provides a quantitative measure of gG's ability to interfere with chemokine-induced cell migration . Results should demonstrate significantly reduced neutrophil migration in the presence of functional EHV-1 gG compared to control conditions.

How can researchers generate and validate EHV-1 gG deletion mutants?

Creating gG deletion mutants is essential for studying gG function through loss-of-function approaches. The process involves:

  • Constructing a transfer plasmid containing viral sequences flanking the gG gene but with the gG coding sequence deleted

  • Co-transfecting this plasmid with wild-type viral DNA into permissive cells

  • Selecting recombinant viruses through plaque purification

  • Verifying the deletion through PCR, restriction enzyme analysis, and sequencing

  • Confirming the absence of gG expression through Western blotting

Validation of the gG deletion mutant should include:

  • Growth kinetics comparison with wild-type virus in cell culture

  • Plaque size and morphology assessment

  • Western blot analysis to confirm the absence of gG expression

  • Functional assays such as chemotaxis inhibition to demonstrate the loss of chemokine-binding activity

In published studies, supernatants from cells infected with gG-negative mutants (vL11ΔgG, vOH-ΔgG1) were unable to interfere with IL-8-induced equine neutrophil migration, confirming the role of gG in chemotaxis inhibition .

How can recombinant EHV-1 gG be used to differentiate between EHV-1 and EHV-4 infections?

The type-specificity of alphaherpesviruses gG makes it an excellent tool for serological differentiation. To develop a diagnostic assay:

  • Express and purify recombinant EHV-1 gG and EHV-4 gG separately

  • Use these proteins as antigens in ELISA assays

  • Test sera against both antigens and compare binding patterns

The antigenic determinants in the carboxyl domain of gG in both EHV-1 and EHV-4 elicit type-specific antibody responses. This property enables differentiation between antibodies present in polyclonal sera from mixed cases of infection involving both viruses . This differentiation has significant epidemiological implications, as it allows researchers to accurately determine infection history in horses with mixed or sequential infections of these closely related viruses .

The development of type-specific serological assays has been critical for understanding the epidemiology of these viruses, particularly since approximately 80-90% of horses become infected with either EHV-1 or EHV-4 by 2 years of age, and mixed infections are common .

What in vivo models are suitable for studying EHV-1 gG function?

Both murine and equine models have been established for studying EHV-1 gG function:

Murine Model:

  • Use 6-10 week-old female mice (wild-type or knockout strains)

  • Administer 1×10⁴ PFU of EHV-1 (wild-type or gG mutants) intranasally after anesthesia

  • Monitor clinical signs, weight loss, and viral shedding

  • Collect bronchoalveolar lavage (BAL) samples to quantify neutrophil migration using flow cytometry

  • Harvest tissues (lungs, trigeminal ganglia) for viral load determination and histopathology

This model has demonstrated that neutrophil migration to the lungs is significantly reduced in the presence of functional EHV-1 gG .

Equine Model:

For the natural host model, experimental protocols typically involve:

  • Using seronegative horses (preferably young animals)

  • Intranasal inoculation with wild-type or mutant viruses (e.g., 10⁷ PFU)

  • Daily monitoring of clinical parameters (rectal temperature, nasal discharge, lymph node enlargement)

  • Collection of nasal swabs for virus isolation and quantitative PCR

  • Blood sampling for viremia detection and serological testing

  • Bronchoalveolar lavage for local immune response assessment

The equine model allows for evaluation of disease progression, including the crucial step of cell-associated viremia, which is a prerequisite for the most severe manifestations of EHV-1 infection .

How does EHV-1 gG compare functionally with chemokine-binding proteins from other herpesviruses?

EHV-1 gG belongs to a family of viral chemokine-binding proteins (vCKBPs) found in many alphaherpesviruses. Comparative studies reveal:

  • Binding Specificity: EHV-1 gG exhibits broad-spectrum chemokine binding capabilities similar to other alphaherpesvirus gG proteins, though with species-specific differences in affinity and selectivity

  • Secretion vs. Membrane Association: Unlike some herpesvirus vCKBPs that are exclusively membrane-bound, EHV-1 gG exists in both secreted and membrane-associated forms, similar to herpes simplex virus 2 (HSV-2) gG and pseudorabies virus (PRV) gX

  • Structural Organization: EHV-1 gG shares the characteristic feature of proteolytic processing with HSV-2 gG and PRV gX, resulting in secreted N-terminal fragments with chemokine-binding activity

  • Immunomodulatory Potency: In functional assays, EHV-1 gG demonstrates potent inhibition of neutrophil migration both in vitro and in vivo, establishing it as a bona fide vCKBP with significant impact on viral pathogenesis

These comparisons provide valuable insights into the evolution of immune evasion strategies among alphaherpesviruses and highlight the conserved importance of chemokine modulation in viral pathogenesis.

How can recombinant EHV-1 with modified gG be utilized in vaccine development?

Recombinant EHV-1 with modified gG offers promising avenues for vaccine development through several approaches:

  • Attenuated Vaccine Candidates: Deletion or modification of gG can attenuate EHV-1 while maintaining immunogenicity. For example, an EHV-1 mutant with deleted ORF2 (Ab4ΔORF2) showed reduced fever and nasal virus shedding compared to wild-type virus but mounted similar adaptive immunity dominated by antibody responses .

  • Marker Vaccines: The type-specificity of gG allows for the development of DIVA (Differentiating Infected from Vaccinated Animals) vaccines, where serological responses to deleted or modified gG can distinguish vaccinated from naturally infected animals.

  • Vector-based Vaccines: EHV-1 can be engineered as a vector for delivering heterologous antigens. Studies have shown successful delivery of HIV-1 Pr55 precursor using EHV-1 vectors, inducing Gag-specific CD8+ immune responses in mice .

Evaluation of these vaccine candidates involves:

  • Assessing attenuation in vitro through growth kinetics and plaque size

  • Measuring immunogenicity through antibody and cellular immune responses

  • Performing challenge studies to determine protection efficacy

  • Monitoring for adverse effects or reversion to virulence

A comprehensive vaccination study demonstrated that horses previously infected with Ab4ΔORF2 showed improved protection from challenge infection compared to controls, suggesting its potential as a vaccine candidate .

What immune correlates of protection should be evaluated in EHV-1 gG-based vaccine studies?

When evaluating EHV-1 vaccines, especially those with modified gG, several immune correlates should be assessed:

  • Serum Antibody Responses:

    • Virus neutralizing antibody titers by serum neutralization tests

    • Type-specific antibody responses using ELISAs with recombinant gG

    • IgG subtype analysis, particularly IgG4/7 which has been associated with protection

  • Mucosal Immunity:

    • EHV-1-specific antibodies in nasal secretions

    • IgA levels at mucosal surfaces

    • Local cellular responses in nasopharyngeal tissues

  • Cell-mediated Immunity:

    • EHV-1-specific T cell responses (CD4+ and CD8+)

    • Cytokine profiles (IFN-γ, IL-4, etc.)

    • CTL activity against virus-infected cells

  • Protection Markers:

    • Prevention of nasal virus shedding (measured by PCR and virus isolation)

    • Prevention of cell-associated viremia (critical for preventing severe manifestations)

    • Resistance to clinical disease following challenge

Research has shown that protected horses had EHV-1-specific IgG4/7 antibodies prior to challenge infection, and intranasal antibodies increased rapidly post-challenge. Importantly, intranasal inflammatory markers were not detectable in protected horses, suggesting that preexisting nasal IgG4/7 antibodies neutralize EHV-1, prevent viral entry, and thereby protect from disease, viral shedding, and cell-associated viremia .

What experimental protocols best evaluate the efficacy of recombinant EHV-1 vaccines with modified gG?

A comprehensive protocol for evaluating recombinant EHV-1 vaccines should include:

  • Immunization Phase:

    • Group allocation: vaccinated (with different constructs) vs. control groups

    • Administration schedule: typically 2-3 doses at 3-4 week intervals

    • Route of administration: intramuscular, intranasal, or combination

    • Sample collection: serum, nasal swabs, peripheral blood mononuclear cells (PBMCs)

  • Immune Response Evaluation:

    • Serological assays: virus neutralization tests, gG-specific ELISA

    • Cellular immunity: lymphocyte proliferation, ELISpot, cytokine release assays

    • Mucosal immunity: analysis of nasal secretions for specific antibodies

  • Challenge Study:

    • Controlled exposure to virulent EHV-1 (typically 10⁷ PFU administered intranasally)

    • Daily monitoring for 21 days post-challenge

    • Parameters to monitor:

      • Clinical signs (fever, nasal discharge, neurological symptoms)

      • Viral shedding (quantified by real-time PCR and virus isolation)

      • Cell-associated viremia (by co-cultivation and PCR)

      • Inflammatory markers in nasal secretions

  • Data Analysis:

    • Statistical comparison between groups

    • Correlation between immune parameters and protection

    • Identification of immune correlates of protection

Recent studies have employed this approach to demonstrate that horses previously infected with Ab4ΔORF2 showed significant protection from challenge infection. Five out of eight horses were fully protected as indicated by the absence of fever, clinical disease, nasal virus shedding, and viremia, while the remaining three showed significantly reduced symptoms compared to controls .

What are the current technical challenges in working with recombinant EHV-1 gG?

Researchers face several technical challenges when working with recombinant EHV-1 gG:

  • Protein Expression and Purification:

    • Maintaining proper glycosylation patterns in recombinant systems

    • Achieving high yields of functional protein

    • Purifying secreted vs. membrane-associated forms separately

    • Preserving the native conformation during purification

  • Functional Characterization:

    • Developing standardized assays for chemokine-binding activity

    • Identifying the full spectrum of chemokines bound by EHV-1 gG

    • Quantifying binding affinities for different chemokines

    • Correlating in vitro binding with in vivo function

  • Structural Analysis:

    • Crystallizing glycosylated proteins for structural studies

    • Mapping the specific regions responsible for chemokine binding

    • Understanding the structural basis for species-specific differences

    • Determining how proteolytic processing affects function

  • In Vivo Studies:

    • Limited availability of specific-pathogen-free horses

    • Variability in equine immune responses

    • High costs associated with large animal studies

    • Ethical considerations in challenge studies

Addressing these challenges requires multidisciplinary approaches and continued refinement of techniques for protein expression, structural biology, and immunological assays.

How can conflicting data about EHV-1 gG function be reconciled?

Research on EHV-1 gG has produced some apparently contradictory results that require careful interpretation:

  • Immunomodulatory vs. Immunostimulatory Effects:

    • While gG primarily functions as an immunomodulatory protein by inhibiting chemokine activity, some studies suggest it may also have immunostimulatory properties in certain contexts

    • These conflicting observations may be reconciled by considering:

      • Different molecular forms of gG (full-length vs. cleaved fragments)

      • Concentration-dependent effects

      • Cell type-specific responses

      • Timing of expression during infection

  • Structure-Function Relationships:

    • Studies inserting the hypervariable region of EHV-4 gG into EHV-1 gG (vOH-gG1hyp4) did not lead to a complete loss of chemokine-binding function

    • Re-insertion of the predicted chemokine-binding region of EHV-1 gG in EHV-4 gG (vOH-gG4hyp1) did not completely restore inhibitory function

    • These findings suggest that multiple regions contribute to function, and the interaction between these regions is complex

  • In Vitro vs. In Vivo Findings:

    • Reconciling differences between in vitro chemotaxis assays and in vivo outcomes requires:

      • Comparing matched experimental systems

      • Considering the complexity of in vivo environments

      • Accounting for compensatory mechanisms in animals

      • Using multiple methods to evaluate the same parameters

A systematic approach comparing different gG variants in standardized assays, followed by in vivo validation in both murine and equine models, would help resolve these discrepancies.

What novel applications of recombinant EHV-1 gG might emerge in future research?

Several innovative applications for recombinant EHV-1 gG may develop in the near future:

  • Therapeutic Applications:

    • Development of gG-derived peptides as anti-inflammatory agents

    • Engineering gG as a delivery vehicle for targeted immunomodulation

    • Utilizing gG to control excessive neutrophil recruitment in inflammatory diseases

  • Diagnostic Advances:

    • Multi-pathogen serological arrays incorporating type-specific gG proteins

    • Point-of-care tests for rapid differentiation of EHV-1 and EHV-4 infections

    • Monitoring tools for evaluating vaccine efficacy in field conditions

  • Vector Technology:

    • Enhanced EHV-1 vectors with optimized gG for targeted delivery of therapeutic genes

    • Development of safe, attenuated EHV-1 vectors for human vaccine applications

    • Mucosal delivery systems based on EHV-1 tropism and gG properties

  • Fundamental Research:

    • Use of gG to probe chemokine networks in various disease models

    • Structural studies to inform development of novel immunomodulators

    • Comparative studies across species to understand host-pathogen co-evolution

  • Vaccine Design Principles:

    • Rational attenuation strategies based on gG modification

    • Development of universal herpesvirus vaccine platforms

    • Mucosal immunity enhancement through targeted gG engineering

These future directions represent the potential for translating basic research on EHV-1 gG into applications with broader impact in both veterinary and human medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.