Recombinant Equine herpesvirus 1 Envelope glycoprotein I (GI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
gI; 73; Envelope glycoprotein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-424
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)
Target Names
gI
Target Protein Sequence
IIYRGEHMSMYLNASSEFAVYPTDQSLVLVGHLLFLDGQRLPTTNYSGLIELIHYNYSSV CYTVIQTISYESCPRVANNAFRSCLHKTSKHYHDYFRVNASVETNVLLNITKPQPTDSGA YILRVKLDHAPTADVFGVSAFVYDLKSKTVPDPMPTTQTVEPTTSYVSTPTYDYTDDVTT ETESTSTSTQQAMTSTQTPSATWGTQLTTELPTNETVVIGQEALLCHWFQPSTRVPTLYL HLLGRTGNLPEDVLLVEDSEFLRTTSPAHRPSASPADGDDFKQTNSTSLKARNKIVAMVV IPTACVLMLLLVVVGAIINGAVRKHLLSCASRRIYRSGQGGASAAERRRLTCGPTLAASS ESLADDTTSSPPTPKPSKKTKLETDPLMEQLNRKLEAIKEES
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is crucial for cell-to-cell viral spread. It facilitates the sorting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional cellular receptors. It's implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for anterograde spread of infection throughout the nervous system. In conjunction with US9, gE/gI participates in the sorting and transport of viral structural components to axon terminals.

Database Links

KEGG: vg:2948579

Protein Families
Alphaherpesvirinae glycoprotein I family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is the biological function of EHV-1 glycoprotein I?

EHV-1 glycoprotein I (gI) primarily functions as part of a heterodimer with glycoprotein E (gE). In epithelial cells, this gE/gI complex is required for the cell-to-cell spread of the virus by sorting nascent virions to cell junctions. Once the virus reaches these junctions, viral particles can spread to adjacent cells rapidly through interactions with cellular receptors that accumulate at these sites. Additionally, gI is implicated in basolateral spread in polarized cells. In neuronal cells, the gE/gI complex is essential for anterograde spread of the infection throughout the host nervous system .

What is known about the molecular characteristics of recombinant EHV-1 gI?

Recombinant EHV-1 gI (strain AB1) spans amino acids 23-424 and can be produced with either a His-tag or in tag-free form. The protein has a Uniprot ID of P68326 and a Gene ID of 2948579. When analyzed by SDS-PAGE, purified recombinant gI demonstrates >90% purity. The biological activity of the recombinant protein can be measured by its binding ability in functional ELISA assays .

How does EHV-1 gI compare structurally to other herpesvirus glycoproteins?

While specific crystal structure data for EHV-1 gI is not as extensively documented as for glycoprotein D, gI shares functional homology with other herpesvirus gI proteins. The general structure of herpesvirus envelope glycoproteins often includes an immunoglobulin-like (IgV-like) core domain, though this has been more extensively characterized for glycoprotein D than for gI. When co-expressed with gE, EHV-1 gI appears to facilitate proper folding and expression of the gE partner, suggesting structural interdependence similar to that observed in other herpesviruses .

What expression systems are most effective for producing recombinant EHV-1 gI?

E. coli cell-free expression systems have been successfully used to produce recombinant EHV-1 envelope glycoprotein I (strain AB1), specifically the fragment spanning amino acids 23-424. This approach allows for production with either a His-tag or in tag-free form . For more complex studies involving glycosylation patterns, mammalian expression systems such as 293T cells have also been employed, particularly when co-expressing gI with gE to enhance proper folding and antigenicity .

What challenges are commonly encountered when expressing recombinant EHV-1 gI?

A significant challenge in expressing recombinant EHV-1 gI is obtaining properly folded, functional protein. When expressed individually, gI appears to have reduced antigenicity compared to when it is co-expressed with gE. Research has shown that co-expression of gE and gI enhances the antigenicity of both proteins, suggesting that they might be required for each other's efficient expression and proper folding. This interdependence complicates the production of functional recombinant gI in isolation .

What purification methods yield the highest purity for recombinant EHV-1 gI?

For His-tagged recombinant EHV-1 gI, immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography (SEC) is an effective purification strategy. This approach has been demonstrated to achieve >90% purity as determined by SDS-PAGE. For tag-free versions, alternative chromatographic methods may be required. Quality control typically includes SDS-PAGE analysis and functional ELISA to confirm both purity and biological activity of the purified protein .

How can the biological activity of recombinant EHV-1 gI be assessed?

The biological activity of recombinant EHV-1 gI can be measured using functional ELISA assays that assess binding capacity. Additionally, researchers have employed immunoblot analysis using horse sera against EHV-1 to evaluate antigenicity. When studying functional aspects of gI in the context of viral infection, virus blocking assays can be conducted where cells are pre-incubated with recombinant protein and subsequently challenged with virus. Flow cytometry can then be used to quantify the reduction in infection, providing insight into the protein's functional role .

What experimental approaches can be used to study gI-mediated cell-to-cell spread?

To study gI-mediated cell-to-cell spread, researchers can employ several approaches:

  • Plaque size assays: Comparing plaque sizes between wild-type virus and gI-deficient mutants can provide quantitative data on cell-to-cell spread efficiency.

  • Co-culture experiments: Infected cells can be co-cultured with uninfected cells separated by a membrane that prevents free virus passage but allows cell-to-cell contact.

  • Time-lapse microscopy: Fluorescently labeled viruses can be tracked in real-time to visualize the dynamics of cell-to-cell spread.

  • Complementation assays: Cell lines stably expressing gI can be used to complement gI-deficient viral mutants to confirm specific roles of gI in cell-to-cell spread .

How does co-expression of gE and gI enhance their antigenicity?

Co-expression of EHV-1 gE and gI significantly enhances their antigenicity compared to individual expression. In studies using 293T cells, co-expressed gE and gI showed stronger reactions with horse sera against EHV-1 than when expressed individually. Specifically, co-expression resulted in two additional bands (80-90 kDa and 250 kDa) that were not observed with individual expression of either protein. These bands were recognized by both horse sera against EHV-1 and mouse antibody specific to gE, suggesting the formation of a complex that more effectively presents epitopes to the immune system. This indicates that gI might be required for efficient expression and proper folding of gE, and potentially vice versa .

How do EHV-1 gI and EHV-4 gI differ functionally despite their sequence similarity?

EHV-1 and EHV-4 share significant genetic and antigenic similarity, with their glycoproteins showing 55-96% identity at the amino acid level. Despite this similarity, they exhibit striking differences in pathogenic potential and cellular tropism. EHV-1 can readily propagate in many cell types of multiple species, while EHV-4 entry and replication appear more restricted to equine cells. These differences may be partly attributed to variations in glycoproteins involved in virus entry and cell-to-cell spread, including gI. While specific functional differences between EHV-1 gI and EHV-4 gI have not been fully characterized, their role in complex formation with gE and subsequent impact on cellular tropism may contribute to the observed pathogenic differences .

How can recombinant EHV-1 gI contribute to vaccine development strategies?

Recombinant EHV-1 gI has potential applications in vaccine development due to its strong immunogenicity when co-expressed with gE. Research has shown that at least six glycoproteins of EHV-1, including gI, are immunogenic to horses. The enhanced antigenicity observed when gI is co-expressed with gE suggests that a vaccine containing both proteins might elicit stronger immune responses. Additionally, understanding the specific epitopes of gI recognized by the immune system could guide the design of subunit vaccines targeting these regions. The ability to produce recombinant gI with high purity (>90%) makes it a viable candidate for inclusion in subunit or recombinant protein-based vaccines .

What role might gI play in developing diagnostic tools for EHV-1 infection?

Recombinant EHV-1 gI, particularly when co-expressed with gE, shows strong reactivity with horse sera from EHV-1-infected animals, making it potentially valuable for diagnostic applications. These proteins could be used in ELISA-based serological tests to detect anti-EHV-1 antibodies in horse serum samples. The high immunogenicity of gI suggests it could serve as an effective antigen in such assays. Additionally, antibodies generated against recombinant gI could be used in immunohistochemistry or immunofluorescence assays to detect viral antigens in tissue samples from suspected cases of EHV-1 infection .

How can mutagenesis studies of gI inform our understanding of EHV-1 virulence?

Targeted mutagenesis of EHV-1 gI can provide valuable insights into the protein's role in viral virulence and pathogenesis. By creating specific mutations in key functional domains of gI and assessing their impact on viral replication, cell-to-cell spread, and pathogenicity in suitable models, researchers can identify critical residues for gI function. Similar approaches with glycoprotein D identified key residues (F213 and D261) that, when mutated, resulted in impaired virus growth. Analogous studies with gI could reveal residues essential for complex formation with gE or for interactions with cellular factors facilitating viral spread. These findings could potentially identify novel targets for antiviral interventions .

What methodologies are suitable for studying the interaction between gI and gE?

Several methodologies can be employed to study the interaction between EHV-1 gI and gE:

  • Co-immunoprecipitation assays can detect physical interactions between gI and gE when co-expressed in suitable cell lines.

  • Bimolecular fluorescence complementation (BiFC) can visualize protein-protein interactions in living cells.

  • Surface plasmon resonance (SPR) spectroscopy can measure binding kinetics and affinity between purified recombinant gI and gE proteins.

  • Yeast two-hybrid or mammalian two-hybrid systems can identify specific domains involved in the interaction.

  • Cryo-electron microscopy or X-ray crystallography could potentially resolve the structure of the gE/gI complex, though this has been challenging and not yet reported for EHV-1 .

How can advanced imaging techniques enhance our understanding of gI function in viral spread?

Advanced imaging techniques can significantly enhance our understanding of EHV-1 gI function in viral spread:

  • Super-resolution microscopy (e.g., STED, PALM, STORM) can visualize the distribution and dynamics of gI at cell junctions with nanometer-scale resolution.

  • Live-cell imaging combined with fluorescently labeled viral particles can track the real-time movement of virions in the presence or absence of functional gI.

  • Correlative light and electron microscopy (CLEM) can link the fluorescence signals of labeled gI with ultrastructural details of virion assembly and trafficking.

  • Fluorescence recovery after photobleaching (FRAP) can assess the mobility of gI within cellular membranes and at cell junctions.

These techniques could provide unprecedented insights into how gI facilitates the sorting of nascent virions to cell junctions and promotes cell-to-cell spread .

How should researchers interpret differences in gI molecular weight observed in different experimental systems?

Variations in observed molecular weights of EHV-1 gI across different experimental systems are common and can be attributed to several factors:

  • Post-translational modifications, particularly glycosylation, can significantly alter the apparent molecular weight in SDS-PAGE. Recombinant gI produced in E. coli will lack mammalian glycosylation patterns.

  • When co-expressed with gE, additional bands of 80-90 kDa and 250 kDa have been observed, which may represent complexes or differently processed forms of the proteins.

  • The presence or absence of tags (e.g., His-tag) can also affect migration patterns in gel electrophoresis.

When interpreting such differences, researchers should consider the expression system used, potential post-translational modifications, and whether the protein was expressed alone or in combination with interaction partners. Techniques such as glycosidase treatment, western blotting with domain-specific antibodies, and mass spectrometry can help resolve the true identity of differently sized protein bands .

What are common pitfalls in functional assays for recombinant EHV-1 gI and how can they be addressed?

Common pitfalls in functional assays for recombinant EHV-1 gI include:

  • Improper folding: Recombinant gI may not fold correctly when expressed without gE, leading to reduced antigenicity and functional activity. Co-expression with gE can enhance proper folding.

  • Degradation during purification: Proteolytic degradation can occur during purification, affecting functional assays. Including protease inhibitors and optimizing purification conditions can minimize this issue.

  • Interference from tags: His-tags or other affinity tags might interfere with protein function. Using tag-free versions or comparing tagged and untagged proteins can address this concern.

  • Cell type specificity: Results from functional assays may vary depending on the cell type used. Using equine-derived cells when possible, or comparing multiple cell types, can provide more comprehensive insights.

  • Concentration effects: Both too high and too low concentrations of recombinant protein can lead to misleading results in blocking assays. Utilizing appropriate concentration ranges and controls is essential .

What emerging technologies might advance our understanding of EHV-1 gI structure and function?

Several emerging technologies hold promise for advancing our understanding of EHV-1 gI:

  • Cryo-electron microscopy: This technique could potentially resolve the structure of the gE/gI complex and how it facilitates virion sorting to cell junctions.

  • CRISPR/Cas9 genome editing: This could enable precise modifications of gI in the viral genome to study structure-function relationships.

  • Single-molecule imaging: These techniques could visualize the dynamics of individual gI molecules during viral assembly and cell-to-cell spread.

  • Protein-protein interaction screening: Methods such as BioID or APEX proximity labeling could identify novel cellular partners of gI.

  • Organoid models: Equine airway or neuronal organoids could provide more physiologically relevant systems for studying gI function in viral pathogenesis.

  • Structural prediction using AI: Tools like AlphaFold could predict the structure of gI and its complexes, generating hypotheses for experimental validation .

How might systems biology approaches enhance our understanding of gI in the context of complete viral infection?

Systems biology approaches could provide a more holistic understanding of EHV-1 gI function:

  • Proteomics: Quantitative proteomics could identify changes in the host cell proteome in response to wild-type versus gI-deficient viruses.

  • Interactomics: Comprehensive mapping of protein-protein interactions could position gI within the network of viral and host proteins during infection.

  • Transcriptomics: RNA-seq analysis could reveal how gI affects host cell gene expression patterns during infection.

  • Computational modeling: Integration of multiple data types could enable mathematical modeling of how gI contributes to viral replication and spread dynamics.

  • Single-cell analyses: These could reveal cell-to-cell heterogeneity in responses to gI and how this affects viral spread within a population.

These approaches could reveal unexpected functions of gI beyond its known role in cell-to-cell spread and provide targets for therapeutic intervention .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.