Recombinant Equine herpesvirus 1 Envelope protein UL45 homolog (15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
15; Envelope protein UL45 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)
Target Names
15
Target Protein Sequence
MEDYKLLQLETATVDAQAPPLPTKTVPVFAPPLSTPPQPNELVYTKRRRTKRKAKCRCLF FTMGMFALGVLMTTAILVSTFILTVPIGALRTAPCPAETFGLGDECVRPVLLNASSNTRN ISGVGAVCEEYSEMAASNGTAGLIMSLLDCLNVGDSESVMNKLNLDDTQLAYCNVPSFAE CYTKGFGVCYAARPLSPLGELIYKARQALRLDHIIPFPR
Uniprot No.

Target Background

Protein Families
Herpesviridae HHV-1 UL45 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the Equine Herpesvirus 1 Envelope Protein UL45 Homolog?

The Equine herpesvirus 1 (EHV-1) UL45 homolog encodes a glycosylated protein that functions as a type II membrane glycoprotein in infected cells . The full-length protein consists of 219 amino acids (P28981) and is often referred to as ORF15 or membrane protein UL45 in scientific literature . Studies using antiserum generated against the carboxyl-terminal 114 amino acids of the EHV-1 UL45 protein have detected specific proteins of molecular weights 32,000, 40,000, and 43,000 Daltons in EHV-1-infected cells . The protein undergoes post-translational modifications, particularly glycosylation, which accounts for the different molecular weight forms observed in infected cells .

Where is the UL45 Protein Localized During Viral Infection?

Fractionation studies have demonstrated that the EHV-1 UL45 protein is not present in purified virions of EHV-1 wild-type strain RacL22 or the modified live vaccine strain RacH . Instead, it is expressed as a late (gamma-2) protein during the viral replication cycle and remains associated with infected cells rather than being incorporated into the viral particle structure . This localization pattern suggests that UL45 may function primarily at the cellular level during viral replication rather than as a structural component of the mature virion.

What Expression Systems Are Optimal for Producing Recombinant EHV-1 UL45 Protein?

Recombinant EHV-1 UL45 protein can be successfully expressed using multiple expression systems, each with specific advantages depending on research requirements. The most commonly used expression systems include:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications
YeastSome post-translational modifications, high yieldPotential hyperglycosylation
BaculovirusCloser to native glycosylation, high expressionMore complex system, longer production time
Mammalian CellMost authentic post-translational modificationsLower yields, higher cost, longer production time
Cell-Free ExpressionRapid, avoids cell toxicity issuesTypically lower yields

For basic structural studies or antibody production, E. coli-expressed protein with an N-terminal His-tag provides a practical solution, achieving purity levels of ≥85% as determined by SDS-PAGE . For functional studies requiring glycosylation patterns similar to the native viral protein, mammalian or baculovirus expression systems are preferable despite their higher complexity .

What Purification Strategy Is Most Effective for Recombinant UL45 Protein?

  • Affinity chromatography using His-tag (IMAC)

  • Ion-exchange chromatography to separate charged variants

  • Size-exclusion chromatography for final polishing and buffer exchange

For glycosylated forms produced in eukaryotic systems, additional considerations for glycoform heterogeneity must be addressed, potentially requiring lectin affinity chromatography steps . Purity assessment should be performed using SDS-PAGE and, when necessary, Western blotting with anti-His antibodies or specific antibodies against the UL45 protein .

What Is the Role of UL45 in EHV-1 Viral Replication and Pathogenesis?

Deletion studies have established that UL45 is nonessential for EHV-1 growth in vitro, but its absence significantly reduces viral replication efficiency . Specifically, deletion of the UL45 gene in both RacL22 and RacH strains (LΔ45 and HΔ45) resulted in a marked reduction of virus release . Interestingly, the deletion had no significant influence on plaque size or on the syncytial phenotype of the EHV-1 strain RacH .

These findings suggest that while UL45 is not absolutely required for viral replication, it plays an important role in optimizing viral replication kinetics, particularly in the virus release phase of the replication cycle. The precise molecular mechanism through which UL45 facilitates virus release remains to be fully elucidated and represents an important area for future research.

How Does UL45 Compare to Homologous Proteins in Other Herpesviruses?

The UL45 protein has homologs across various herpesviruses, with notable functional divergence. In Human Cytomegalovirus (HCMV), the UL45 homolog encodes a ribonucleotide reductase-like protein that is dispensable for virus growth in both human fibroblasts and human endothelial cells . This contrasts with the role of UL45 in EHV-1, where deletion reduces replication efficiency .

In murine cytomegalovirus, the M45 protein (homologous to HCMV UL45) functions as an antiapoptotic protein, but studies have not definitively established whether the EHV-1 UL45 homolog shares this function . Comparative studies between UL45 homologs from EHV-1 and EHV-4 may also provide insights into the functional specialization of these proteins, given the differing pathogenic profiles of these closely related viruses .

What Approaches Can Be Used to Study UL45 Protein-Protein Interactions?

To investigate the protein-protein interactions of UL45, researchers should consider a multi-method approach:

  • Co-immunoprecipitation (Co-IP): Using antibodies against UL45 to pull down potential binding partners from infected cell lysates, followed by mass spectrometry identification.

  • Yeast Two-Hybrid Screening: Expressing UL45 as bait to screen a library of equine cDNAs for potential interacting partners.

  • Proximity Labeling: Expressing UL45 fused to a biotin ligase (BioID or TurboID) to biotinylate proximal proteins in living cells, followed by streptavidin pulldown and mass spectrometry.

  • Surface Plasmon Resonance (SPR): For quantitative assessment of binding kinetics between purified UL45 and candidate binding partners.

Each method has strengths and limitations, and combining multiple approaches increases confidence in identified interactions. Validation of identified interactions should include reciprocal Co-IP and functional studies to assess the biological relevance of the interaction .

How Can Researchers Generate and Validate UL45 Deletion Mutants?

Creating reliable UL45 deletion mutants requires careful consideration of the following methodology:

  • Bacterial Artificial Chromosome (BAC) Technology: Similar to the approach used for HCMV UL45 deletion , the EHV-1 genome can be maintained as a BAC in E. coli to facilitate genetic manipulation.

  • Homologous Recombination Strategy: Design recombination cassettes with 50-100bp homology arms flanking the UL45 coding region, including a selectable marker (e.g., kanamycin resistance).

  • Confirmation of Deletion:

    • Restriction enzyme digestion patterns: In an EcoRI digest, expect a shift from a 3.4-kb fragment to a smaller fragment depending on the deletion design .

    • PCR verification using primers flanking the deletion site

    • Southern blotting with UL45-specific probes

    • Whole-genome sequencing to confirm the absence of unwanted mutations

  • Phenotypic Validation: Compare growth kinetics, plaque morphology, and virus release between wild-type and deletion mutants in relevant cell types .

  • Complementation Studies: Re-express UL45 in trans or revert the deletion to confirm that observed phenotypes are specifically due to the absence of UL45 .

What Is the Relationship Between UL45 and EHV-1 Pathogenesis in Equines?

While UL45 has been characterized as a nonessential protein for in vitro replication, its potential role in pathogenesis within the natural host requires further investigation . EHV-1 causes various clinical manifestations in equines, including respiratory disease, abortion, neonatal death, and neurological disease . The specific contribution of UL45 to these disease outcomes remains unclear.

Researchers investigating this relationship should consider:

  • Comparing UL45 sequences from strains associated with different clinical presentations

  • Evaluating UL45 deletion mutants in appropriate ex vivo models (e.g., equine respiratory epithelial explants)

  • Analyzing UL45 expression patterns during different stages of infection and in different tissues

Could UL45 Serve as a Target for Antiviral Development or Vaccine Design?

Current vaccines against EHV-1 provide incomplete protection, especially against the neurological form . Therefore, exploration of additional viral targets, potentially including UL45, may contribute to improved vaccine strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.