Recombinant Equine herpesvirus 1 Envelope protein US9 homolog (76)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Equine Herpesvirus 1 Envelope Protein US9 Homolog (76)

Recombinant Equine Herpesvirus 1 Envelope protein US9 homolog (76) refers to a protein encoded by the ORF76 gene in Equine Herpesvirus type 1 (EHV-1) . EHV-1 is an alphaherpesvirus known to cause rhinopneumonitis, abortion, and neurological issues such as equine herpesvirus myeloencephalopathy (EHM) in horses. It can also induce lethal encephalitis in laboratory animals like mice . The ORF76 gene is a homolog of the herpes simplex virus-1 (HSV-1) US9 gene and encodes a tegument protein, US9, which functions as a herpesvirus kinase . US9 homologs are highly conserved among herpesviruses .

Genetic Characteristics and Conservation

The EHV-1 US9 gene consists of 660 nucleotides, encoding a protein of 219 amino acids with a molecular mass of approximately 22.287 kDa . US9 proteins are enriched with serine and threonine residues and share a conserved domain of highly basic residues followed by a nonpolar amino acid region . Homologs of EHV-1 US9 are found in various herpesviruses, including HSV-1, varicella-zoster virus (VZV), pseudorabies virus (PRV), simian herpesvirus B, bovine herpesvirus 1 (BHV-1), feline herpesvirus 1 (FHV-1), canine herpesvirus, and herpes simplex virus-2 (HSV-2) .

Role in Viral Spread and Neurovirulence

US9 is essential for the anterograde spread of alphaherpesviruses, which involves the movement of the virus from the neuron cell body to the axon terminus . Studies using deletion mutants of ORF76 in EHV-1 have demonstrated that US9 is crucial for the virus's anterograde spread from the olfactory epithelium to the olfactory bulbs . In a mouse infection model, deletion of ORF76 prevented the virus from invading the central nervous system (CNS), underscoring its importance in neuroinvasiveness .

Post-Translational Modifications

Western blot assays have detected multiple bands of EHV-1 US9 ranging from 35 to 42 kDa, which is higher than the expected molecular mass . This suggests that the EHV-1 US9 protein undergoes post-translational modifications, likely phosphorylation . Phosphorylation is believed to alter the charge of the protein, affecting its migration in SDS-PAGE gels and resulting in an apparent higher molecular weight .

Functional Analysis Through Mutant Studies

Deletion mutant studies, such as those using the Ab4pΔORF76 mutant, have been instrumental in elucidating the function of US9 . While the deletion of ORF76 does not affect viral replication or cell-to-cell spread in cultured cells, it significantly impairs the virus's ability to spread within the nervous system . Specifically, the Ab4pΔORF76 mutant was unable to transport to the olfactory bulbs in mice, which prevented CNS infection .

Implications for Pathogenesis

US9's role in anterograde spread and neuroinvasiveness highlights its significance in the pathogenesis of EHV-1-related neurological diseases . The EHV-1 Kentucky A (KyA) strain, which has deletions in genes including US6 (gI), US7 (gE), and US8, is attenuated in mice, further supporting the role of specific genes in EHV-1 virulence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
76; Envelope protein US9 homolog; Envelope protein 76; ORF76 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)
Target Names
76
Target Protein Sequence
MEKAEAAAVVIPLSVSNPSYRGSGMSDQEVSEEQSAGDAWVSAAMAAAEAVAAAATSTGI DNTNDYTYTAASENGDPGFTLGDNTYGPNGAASGCPSPPSPEVVGLEMVVVSSLAPEIAA AVPADTIFASAAAPATRVDDGNAPLLGPGQAQDYDSESGCYYSESDNETASMFIRRVGRR QARRHRRRRVALTVAGVILVVVLCAISGIVGAFLARVFP
Uniprot No.

Target Background

Function
Essential for anterograde spread of infection throughout the host nervous system. In conjunction with the gE/gI heterodimer, US9 facilitates the sorting and axonal transport of viral structural components to nerve terminals.
Database Links

KEGG: vg:2948578

Protein Families
Alphaherpesvirinae envelope protein US9 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein. Host smooth endoplasmic reticulum membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein. Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.