Recombinant Equine herpesvirus 1 Envelope protein US9 homolog (76)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
76; Envelope protein US9 homolog; Envelope protein 76; ORF76 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)
Target Names
76
Target Protein Sequence
MEKAEAAAVVIPLSVSNPSYRGSGMSDQEVSEEQSAGDAWVSAAMAAAEAVAAAATSTGI DNTNDYTYTAASENGDPGFTLGDNTYGPNGAASGCPSPPSPEVVGLEMVVVSSLAPEIAA AVPADTISASAAAPATRVDDGNAPLLGPGQAQDYDSESGCYYSESDNETASMFIRRVGRR QARRHRRRRVALTVAGVILVVVLCAISGIVGAFLARVFP
Uniprot No.

Target Background

Function
Essential for anterograde spread of infection within the host nervous system. US9, in conjunction with the gE/gI heterodimer, plays a crucial role in sorting and transporting viral structural components to axon terminals.
Protein Families
Alphaherpesvirinae envelope protein US9 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein. Host smooth endoplasmic reticulum membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein. Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein.

Q&A

What is the Equine herpesvirus 1 Envelope protein US9 homolog and where is it encoded in the viral genome?

The Equine herpesvirus 1 (EHV-1) Envelope protein US9 homolog is encoded by ORF76 in the unique short (Us) genomic component of EHV-1. It is derived from an open reading frame (ORF) located at the unique short/terminal inverted repeat (Us/TR) junction. Specifically, analysis of a 1353-bp BamHI/PvuII clone has revealed that this region contains 507 bp of Us and 846 bp of TR sequences, with the ORF entirely within the Us region . The gene encoding US9 is positioned as the last gene in the Us segment of EHV-1, which comprises nine ORFs in total, with the complete gene order being US2, protein kinase, gG, US4, gD, gI, gE, 10 kDa, and US9 .

How does the US9 protein of EHV-1 compare structurally to homologous proteins in other herpesviruses?

The US9 protein of EHV-1 encodes a potential polypeptide of 219 amino acids that demonstrates significant homology to US9 proteins found in other herpesviruses, including herpes simplex virus type 1 (HSV-1), EHV-4, pseudorabies virus (PRV), and varicella zoster virus (VZV) . Notably, the US9 polypeptides of the two equine herpesviruses (EHV-1 and EHV-4) exhibit 50% identity but are approximately twice as large as their counterparts in HSV-1, PRV, and VZV . Despite these size differences, all five US9 proteins share common structural features, including enrichment for serine and threonine residues and a conserved domain of highly basic residues followed by a region of nonpolar amino acids, suggesting functional conservation despite evolutionary divergence .

What are the clinical manifestations of EHV-1 infection and how does this relate to US9 function?

EHV-1 infection can manifest in several distinct clinical forms. Primary infection is characterized by upper respiratory tract disease of varying severity, depending on the age and immunological status of the infected equid . More serious complications include abortion, perinatal foal death, and paralytic neurological disease, known as equine herpesvirus myeloencephalopathy (EHM) . The US9 protein plays a crucial role in the neurological manifestation of EHV-1, as it is essential for anterograde spread of the virus within the nervous system . In experimental models, deletion of ORF76 (which encodes US9) resulted in mutant viruses that could not be transported to the olfactory bulbs and were unable to infect the central nervous system, despite normal replication in the olfactory mucosa . This indicates that US9 is specifically involved in the neuroinvasive properties of EHV-1 that contribute to EHM.

How is EHV-1 transmitted and what role might US9 play in this process?

EHV-1 is primarily transmitted through inhalation of aerosols containing virus-laden respiratory secretions . Morbidity tends to be highest in young horses sharing the same air space . Additionally, aborted tissues and placental fluids from infected mares can contain extremely high levels of live virus and represent a major source of infection . While the direct role of US9 in transmission has not been fully elucidated, its function in anterograde neuronal transport suggests it may contribute to viral shedding by facilitating virus movement along neuronal pathways to epithelial surfaces. Studies have shown that US9 is essential for the anterograde spread of EHV-1 in experimental mouse models, where deletion mutants (Ab4p∆ORF76) were unable to spread from the olfactory mucosa to the olfactory bulbs and central nervous system .

What experimental approaches have been used to characterize the function of EHV-1 US9, and what were the key findings?

Researchers have employed several sophisticated experimental approaches to characterize EHV-1 US9 function:

  • Bacterial Artificial Chromosome (BAC) Mutagenesis: Using an EHV-1 BAC clone of neuropathogenic strain Ab4p (pAb4p BAC), researchers constructed an ORF76 deletion mutant (Ab4p∆ORF76) by replacing ORF76 with the rpsLneo gene . This genetic manipulation approach allowed for precise deletion of the US9-encoding gene while maintaining viral viability.

  • In Vitro Cell Culture Studies: Deletion mutants were assessed for replication capacity, cell-to-cell spread in cultured cells, and replication in primary neuronal cells. Interestingly, deletion of ORF76 had no influence on these in vitro parameters, suggesting US9 is dispensable for basic viral replication functions .

  • Protein Detection Methods: Western blot analysis of EHV-1-infected cell lysates using EHV-1 US9-specific polyclonal antibodies detected multiple bands ranging from 35 to 42 kDa, suggesting post-translational modifications of the US9 protein .

  • Animal Infection Models: In a CBA/N1 mouse infection model following intranasal inoculation, researchers compared the parent virus, Ab4p∆ORF76 mutant, and revertant virus. While all viruses replicated similarly in the olfactory mucosa, the Ab4p∆ORF76 mutant was not transported to the olfactory bulbs and failed to infect the CNS, demonstrating US9's essential role in anterograde spread and neuroinvasion .

These findings collectively establish US9 as critical for EHV-1 neuroinvasion but dispensable for basic viral replication and cell-to-cell spread in vitro.

How do antibody responses against EHV-1 envelope proteins like US9 develop, and what implications does this have for diagnostic assays and vaccines?

The antibody response against EHV-1 envelope proteins is complex and involves both type-specific and cross-reactive components, particularly in relation to the closely related EHV-4. Recent research has focused on antibody responses against the receptor-binding glycoprotein D of EHV-1 (gD1), which shares 77% amino acid identity with its EHV-4 counterpart (gD4) .

Studies using luciferase immunoprecipitation system (LIPS) assays with different fragments of gD1 (gD1_83, gD1_160, gD1_180, and gD1_402) have identified both type-specific and cross-reactive epitopes . Specifically, the gD1_83 fragment (comprising the first 83 amino acids) was able to discriminate between "true positive" and "true negative" samples, identifying horses with antibodies that cannot be explained by exposure to EHV-4 alone .

Analysis of horse sera grouped by vaccination status revealed important patterns:

Antibody StatusVaccinatedUnvaccinatedUnknown Status
gD1_83 "true positive"1121
Other reaction patterns7MultipleUnknown

These findings suggest that type-specific antibodies against EHV-1 can be provoked by immunization, though they are rarely identified in natural infections where cross-reacting antibodies common to EHV-1 and EHV-4 prevail . This has significant implications for vaccine development, suggesting that future vaccines should avoid type-common antigens while favoring a broad range of type-specific antigens to enhance protective immunity against EHV-1-specific complications like EHM .

What are the molecular mechanisms by which US9 mediates anterograde transport of EHV-1, and how might this be targeted for therapeutic intervention?

The molecular mechanisms by which US9 mediates anterograde transport of EHV-1 involve specific structural domains that interact with the neuronal transport machinery. Although the exact mechanisms for EHV-1 US9 are still being elucidated, insights from homologous proteins in related herpesviruses provide valuable clues:

  • Conserved Structural Features: EHV-1 US9 contains a conserved domain of highly basic residues followed by a region of nonpolar amino acids . These features are likely important for interactions with cellular transport proteins and membrane association.

  • Post-translational Modifications: Western blot analysis has revealed that US9 exists as multiple protein species ranging from 35 to 42 kDa , suggesting post-translational modifications that may regulate its function in anterograde transport.

  • Kinesin-dependent Transport: By analogy with US9 proteins from other herpesviruses, EHV-1 US9 likely interacts with kinesin motor proteins either directly or through adaptor proteins to facilitate anterograde transport along microtubules from neuronal cell bodies to axon terminals.

  • Selective Sorting of Viral Components: US9 may play a role in selectively sorting viral structural components and envelope proteins into transport vesicles for delivery to axon terminals.

This understanding offers several potential therapeutic targets:

  • Small molecule inhibitors that disrupt US9 interactions with cellular transport machinery

  • Peptide-based inhibitors mimicking interaction domains

  • siRNA or antisense oligonucleotides targeting US9 expression

  • CRISPR-based approaches to modify US9 function in infected cells

Since US9 deletion has no impact on basic viral replication but specifically affects neuroinvasion , targeting this protein could potentially prevent neurological complications of EHV-1 without affecting the ability to mount protective immune responses against the virus.

What are the optimal methods for expressing and purifying recombinant EHV-1 US9 protein for structural and functional studies?

To effectively express and purify recombinant EHV-1 US9 protein for structural and functional studies, researchers should consider the following methodological approach:

  • Expression System Selection:

    • Bacterial Systems: Though economical, bacterial systems may struggle with proper folding and post-translational modifications of US9. If used, consider fusion tags (MBP, SUMO) to enhance solubility.

    • Insect Cell/Baculovirus Systems: These provide superior eukaryotic post-translational modifications and are likely optimal for US9, which shows multiple bands (35-42 kDa) in Western blots, suggesting important modifications .

    • Mammalian Expression Systems: Consider HEK293 or CHO cells for studies requiring native mammalian post-translational modifications.

  • Construct Design:

    • Include the complete 219 amino acid sequence of US9

    • Consider adding purification tags (His6, FLAG, or GST) at N- or C-terminus

    • For membrane association studies, maintain the nonpolar region intact

    • Design truncation constructs (similar to the gD1 fragments approach ) to study domain-specific functions

  • Purification Strategy:

    • Membrane protein extraction using appropriate detergents (e.g., DDM, CHAPS)

    • Affinity chromatography using tag-specific resins

    • Size exclusion chromatography for final polishing

    • Consider native purification conditions to maintain functional conformation

  • Quality Control Assessments:

    • SDS-PAGE and Western blotting with US9-specific antibodies to verify identity

    • Mass spectrometry to confirm sequence and identify post-translational modifications

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to evaluate homogeneity

  • Functional Validation:

    • Binding assays with potential interaction partners from the neuronal transport machinery

    • Liposome reconstitution for membrane association studies

    • In vitro phosphorylation assays to assess kinase interactions

This methodological approach accounts for the unique characteristics of US9, including its post-translational modifications and membrane-association properties, to produce functional protein suitable for downstream structural and functional analyses.

What animal models are most appropriate for studying EHV-1 US9 function in neurological disease, and what are their limitations?

Several animal models have been employed to study EHV-1 US9 function in neurological disease, each with specific advantages and limitations:

  • Mouse Models:

    • The CBA/N1 mouse model has been successfully used to demonstrate US9's role in neuroinvasion .

    • Advantages: Well-characterized genetics, ease of handling, availability of immunological reagents, and cost-effectiveness.

    • Limitations: Mice are not natural hosts for EHV-1, potentially limiting the clinical relevance of findings. Additionally, the pathogenesis may differ from that observed in horses, particularly regarding immune responses.

    • Methodology: Intranasal inoculation followed by monitoring viral spread to olfactory bulbs and brain through immunohistochemistry, PCR, and histopathology .

  • Hamster Models:

    • Hamsters have been used for studying EHV-1 encephalitis .

    • Advantages: More susceptible to EHV-1 neurological disease than mice, providing a robust model for neuroinvasion.

    • Limitations: Fewer genetic and immunological tools compared to mice, and still not the natural host.

    • Methodology: Similar to mouse models, with intranasal infection followed by neurological assessment.

  • Horse Models:

    • As the natural host, horses provide the most clinically relevant model.

    • Advantages: Natural host with authentic pathogenesis, immune responses, and clinical signs.

    • Limitations: Significant cost, ethical considerations, variability in previous exposure and immune status, and limited availability of specific reagents.

    • Methodology: Experimental infection follows natural routes (respiratory), with monitoring for viremia, antibody responses, and neurological signs. Cerebrospinal fluid analysis and advanced imaging can provide additional insights.

  • Ex Vivo Models:

    • Tissue explants from horses or organotypic cultures can bridge in vitro and in vivo approaches.

    • Advantages: Allow detailed study of virus-tissue interactions while maintaining tissue architecture.

    • Limitations: Lack systemic components, particularly immune cells and responses.

    • Methodology: Explants from relevant tissues (respiratory epithelium, neurons) can be infected and monitored for viral spread and cellular responses.

The optimal approach often involves a combination of models, starting with in vitro and small animal studies for mechanistic insights, followed by validation in the natural host for clinical relevance. For specific US9 studies, the mouse model has proven valuable for demonstrating the protein's essential role in anterograde transport and neuroinvasion .

How can researchers effectively design deletion and point mutation studies to analyze the functional domains of EHV-1 US9?

Designing effective deletion and point mutation studies for EHV-1 US9 requires careful consideration of protein structure, conservation patterns, and appropriate experimental systems. The following methodological approach is recommended:

  • Structural and Sequence Analysis for Target Selection:

    • Perform multiple sequence alignments of US9 homologs from EHV-1, EHV-4, HSV-1, PRV, and VZV to identify conserved regions .

    • Focus on the conserved domain of highly basic residues and the adjacent nonpolar region that are shared across herpesviruses .

    • Analyze post-translational modification sites suggested by the multiple protein bands (35-42 kDa) observed in Western blots .

    • Identify potential phosphorylation sites, particularly serine and threonine residues which are enriched in US9 .

  • Mutation Design Strategy:

    • Deletion Mutants: Create systematic deletion constructs similar to the approach used with gD1 fragments (gD1_83, gD1_160, etc.) . Target:

      • N-terminal domain

      • Basic residue domain

      • Nonpolar region

      • C-terminal domain

    • Point Mutations: Design alanine scanning mutations of:

      • Conserved basic residues

      • Potential phosphorylation sites (S/T residues)

      • Residues unique to EHV-1 US9 compared to other herpesvirus homologs

  • Vector System Selection:

    • BAC Mutagenesis: The bacterial artificial chromosome system used for the Ab4p∆ORF76 mutant provides an excellent platform for studying mutations in the context of the complete viral genome.

    • Complementation Assays: Express wild-type or mutant US9 in trans in cells infected with US9-null virus to assess functional rescue.

    • Fluorescent Fusion Proteins: Create GFP or mCherry fusions to track localization and transport of mutant proteins.

  • Functional Assays:

    • Anterograde Transport: Assess the ability of mutants to restore neuroinvasion in the CBA/N1 mouse model .

    • Protein Localization: Use confocal microscopy to determine subcellular localization in neuronal cells.

    • Protein-Protein Interactions: Employ co-immunoprecipitation or proximity ligation assays to identify interaction partners affected by specific mutations.

    • Phosphorylation Analysis: Use phospho-specific antibodies or mass spectrometry to determine how mutations affect post-translational modifications.

  • Data Analysis and Validation:

    • Compare phenotypes of different mutants to establish structure-function relationships.

    • Confirm key findings using complementary approaches (e.g., validate in vitro findings in animal models).

    • Consider rescue experiments with homologous proteins from other herpesviruses to assess functional conservation.

This methodological framework will enable researchers to systematically map the functional domains of EHV-1 US9 and understand their roles in anterograde transport and neuroinvasion.

What serological approaches can differentiate between antibody responses to EHV-1 US9 versus cross-reactive responses to homologous proteins from EHV-4?

Distinguishing between antibody responses to EHV-1 US9 and cross-reactive responses to homologous proteins from EHV-4 requires sophisticated serological approaches that focus on type-specific epitopes. Based on methodologies used for other EHV-1 antigens, the following approaches are recommended:

  • Luciferase Immunoprecipitation System (LIPS) Assays:

    • This approach has been successfully used for differentiating antibody responses against glycoprotein D (gD1) fragments .

    • Methodology:

      • Create recombinant US9 fragments of varying lengths from both EHV-1 and EHV-4

      • Express these fragments as luciferase fusion proteins

      • Incubate with equine sera and capture antibody-antigen complexes

      • Measure luciferase activity to quantify binding

    • Advantage: High sensitivity and ability to work with conformational epitopes

  • Peptide-based ELISA:

    • Design synthetic peptides representing regions of US9 that differ between EHV-1 and EHV-4

    • Methodology:

      • Identify divergent sequences within US9 proteins (the 50% sequence identity between EHV-1 and EHV-4 US9 suggests ample opportunity for type-specific epitopes)

      • Synthesize peptides of 15-25 amino acids covering these regions

      • Develop ELISAs using these peptides as capture antigens

      • Test sera for differential binding to EHV-1 vs. EHV-4 peptides

    • Advantage: High specificity for linear epitopes

  • Competitive Inhibition Assays:

    • Use competition between type-specific and cross-reactive antigens to measure relative antibody specificity

    • Methodology:

      • Pre-incubate sera with excess heterologous antigen (EHV-4 US9) to absorb cross-reactive antibodies

      • Test remaining binding activity against EHV-1 US9

      • Compare with binding in the absence of inhibitor

    • Advantage: Can quantify the proportion of type-specific vs. cross-reactive antibodies

  • Two-dimensional Immunoblotting:

    • Separate proteins by both isoelectric point and molecular weight to improve resolution

    • Methodology:

      • Run recombinant EHV-1 and EHV-4 US9 proteins on 2D gels

      • Transfer to membranes and probe with equine sera

      • Compare binding patterns to identify type-specific reactions

    • Advantage: Can detect post-translational modification differences

  • Data Analysis and Validation:

    • Stratify results by vaccination status, as demonstrated in the gD1 study where vaccinated horses showed different patterns of antibody specificity

    • Use sera from known EHV-1-naïve/EHV-4-positive horses (like those from Iceland ) as controls

    • Apply statistical methods to establish cut-off values for "true positive" type-specific responses

The table below summarizes comparative parameters for evaluating these methods:

MethodSensitivitySpecificityTechnical ComplexitySample Requirements
LIPS AssaysHighHighModerate-HighSmall volume (5-10 μL)
Peptide ELISAModerateVery HighLow-ModerateModerate volume (50-100 μL)
Competitive InhibitionModerate-HighHighModerateLarger volume (100-200 μL)
2D ImmunoblottingModerateModerate-HighVery HighModerate volume (50-100 μL)

These approaches, particularly the LIPS assay methodology that successfully differentiated type-specific antibodies against gD1 , provide a framework for developing serological tools specific to EHV-1 US9.

What are the potential applications of recombinant EHV-1 US9 protein in the development of next-generation vaccines against equine herpesvirus myeloencephalopathy?

Recombinant EHV-1 US9 protein holds significant promise for next-generation vaccine development against equine herpesvirus myeloencephalopathy (EHM), particularly given its essential role in neuroinvasion. Several strategic applications can be considered:

  • Subunit Vaccine Components:

    • Recombinant US9 protein, particularly fragments containing type-specific epitopes, could serve as components of subunit vaccines targeting neurological disease.

    • Given that US9 is essential for anterograde spread and neuroinvasion , antibodies targeting this protein might specifically prevent neurological complications without affecting respiratory immunity.

    • The research on gD1 fragments suggests that focusing on type-specific antigens rather than type-common antigens would be beneficial for vaccine development .

  • Live-Attenuated Vaccine Development:

    • The Ab4p∆ORF76 mutant, which replicates normally in vitro and in respiratory epithelium but cannot reach the CNS , represents a potentially ideal template for a live-attenuated vaccine.

    • Such a vaccine could establish respiratory immunity while posing minimal risk of vaccine-associated neurological disease.

    • Further attenuating mutations could be combined with the ORF76 deletion for enhanced safety.

  • Marker Vaccines:

    • US9-deleted vaccines could function as marker vaccines, allowing differentiation between infected and vaccinated animals (DIVA).

    • Diagnostic tests detecting antibodies against US9 could identify naturally infected horses, while vaccinated animals would lack these antibodies.

  • Novel Adjuvant and Delivery Approaches:

    • Recombinant US9 could be incorporated into novel delivery platforms such as:

      • Virus-like particles displaying US9 epitopes

      • Nanoparticle formulations enhancing mucosal immunity

      • mRNA vaccines encoding modified US9 variants

    • These approaches might enhance immunogenicity while maintaining the type-specific focus needed for effective protection.

  • Combination Vaccine Strategies:

    • Based on findings that type-common antibodies are not protective against EHM , vaccine formulations could combine US9 with other type-specific antigens.

    • The serological data suggesting that vaccinated horses show more "true positive" reactions against type-specific epitopes supports this approach .

Implementing these strategies would require careful immunological evaluation to ensure that the immune response targets the appropriate epitopes and provides protection specifically against neuroinvasion. The finding that vaccinated horses showed stronger type-specific antibody responses suggests that current vaccination approaches may already be moving in this direction, but more focused inclusion of neuroinvasion-specific antigens like US9 could enhance protection against EHM.

How might therapeutic targeting of US9-dependent anterograde transport be developed for treating or preventing EHV-1 neurological disease?

Therapeutic targeting of US9-dependent anterograde transport represents a promising approach for treating or preventing EHV-1 neurological disease. Several potential strategies and their methodological considerations include:

  • Small Molecule Inhibitors:

    • Target Identification: Focus on the conserved domain of highly basic residues and the nonpolar region of US9 that likely mediate interactions with the neuronal transport machinery.

    • Screening Methodology:

      • Develop high-throughput screening assays using fluorescently-tagged virus particles in primary neuronal cultures

      • Measure inhibition of anterograde transport using live-cell imaging

      • Validate hits in ex vivo neural tissue explants

    • Candidate Optimization: Structure-activity relationship studies to enhance potency while minimizing toxicity

  • Peptide-based Inhibitors:

    • Design Strategy: Create peptide mimetics of US9 interaction domains that competitively inhibit binding to transport machinery

    • Delivery Considerations:

      • Conjugate to cell-penetrating peptides for enhanced neuronal uptake

      • Consider intranasal delivery to target olfactory neurons, a key route for EHV-1 neuroinvasion

    • Stability Enhancement: Use non-natural amino acids or cyclization to improve pharmacokinetic properties

  • RNA Interference Approaches:

    • siRNA Design: Target conserved regions of US9 mRNA with minimal homology to host transcripts

    • Delivery Systems:

      • Lipid nanoparticles optimized for neuronal delivery

      • AAV vectors with neuronal tropism for sustained expression

    • Timing Considerations: Must be administered early in infection before neuroinvasion occurs

  • CRISPR-based Therapeutics:

    • Approach: Design CRISPR-Cas systems to target and cleave US9 genomic sequences

    • Delivery: AAV vectors targeting neuronal populations at risk

    • Specificity Considerations: Design guide RNAs with minimal off-target effects

  • Combination Therapies:

    • Antiviral + Transport Inhibitor: Combine traditional antivirals (e.g., acyclovir derivatives) with US9 inhibitors

    • Immunomodulation + Transport Inhibition: Combine anti-inflammatory agents to reduce immune-mediated damage with US9 inhibitors

    • Rational Design: Target multiple stages of the viral lifecycle for synergistic effects

  • Prophylactic Applications:

    • High-risk Scenarios: During outbreaks, administer to exposed but asymptomatic horses

    • Post-exposure Protocol: Deliver within the window between respiratory infection and neuroinvasion

    • Targeted Population: Focus on pregnant mares and performance horses at high risk of exposure

The most promising initial approach may be the development of small molecule inhibitors targeting US9-transport protein interactions, as these could potentially be administered orally or intranasally and distribute to relevant neuronal populations. The finding that US9 deletion specifically blocks neuroinvasion without affecting respiratory replication suggests that such inhibitors could effectively prevent neurological disease without interfering with the development of protective immunity against respiratory infection.

What genomic and proteomic approaches could identify host cell factors interacting with EHV-1 US9 during anterograde transport?

Understanding the host cell factors interacting with EHV-1 US9 during anterograde transport requires sophisticated genomic and proteomic approaches. The following methodological strategies would be most effective:

  • Proximity-based Proteomics:

    • BioID/TurboID Method:

      • Generate US9 fusion proteins with biotin ligase (BioID2 or TurboID)

      • Express in neuronal cells, allowing biotinylation of proteins in close proximity to US9

      • Purify biotinylated proteins and identify by mass spectrometry

      • Advantage: Captures transient interactions in living cells

    • APEX2 Proximity Labeling:

      • Create US9-APEX2 fusion proteins

      • Treat cells with biotin-phenol and H₂O₂ for rapid biotinylation of proximal proteins

      • Analyze by mass spectrometry

      • Advantage: Very rapid labeling window (minutes) for capturing dynamic interactions

  • Immunoprecipitation-Mass Spectrometry (IP-MS):

    • Standard Co-IP:

      • Express tagged versions of US9 in neuronal cells

      • Immunoprecipitate US9 complexes

      • Identify interacting partners by mass spectrometry

      • Advantage: Well-established technique that can identify stable interactions

    • Cross-linking IP-MS:

      • Use membrane-permeable crosslinkers to stabilize transient interactions

      • Perform IP followed by LC-MS/MS

      • Advantage: Captures more transient interactions than standard IP

  • CRISPR Screening Approaches:

    • Genome-wide CRISPR Knockout Screen:

      • Develop reporter system where US9-dependent viral transport is linked to a fluorescent output

      • Perform genome-wide CRISPR screen to identify genes whose loss prevents US9-mediated transport

      • Advantage: Unbiased approach to identify essential host factors

    • CRISPR Activation/Interference Screens:

      • Use CRISPRa or CRISPRi libraries to modulate gene expression levels

      • Identify genes whose upregulation or downregulation affects US9 function

      • Advantage: Can identify factors where complete knockout is lethal

  • Transcriptomic Approaches:

    • RNA-Seq Comparison:

      • Compare transcriptomes of cells infected with wild-type EHV-1 versus US9-deletion mutant

      • Identify differentially expressed genes potentially involved in transport

      • Advantage: Can identify downstream effects of US9 expression

    • Ribosome Profiling:

      • Analyze actively translating mRNAs during infection

      • Compare wild-type and US9-mutant infection

      • Advantage: Focuses on actively translated genes rather than transcript abundance

  • Imaging-based Approaches:

    • Fluorescence Resonance Energy Transfer (FRET):

      • Create fluorescent protein fusions with US9 and candidate interaction partners

      • Measure FRET signals in living neurons

      • Advantage: Can observe interactions in real-time in living cells

    • Split-GFP Complementation Assays:

      • Fuse fragments of GFP to US9 and candidate partners

      • Reconstituted fluorescence indicates interaction

      • Advantage: Low background, high signal-to-noise ratio

A comprehensive approach would integrate multiple methods, starting with unbiased screens (proximity labeling, CRISPR) to identify candidates, followed by targeted validation using imaging and biochemical approaches. Given the essential role of US9 in anterograde transport , these methods would likely identify components of the neuronal transport machinery, potentially including kinesin motor proteins, adaptor proteins, and specific lipid raft components involved in the sorting and transport of viral particles.

How can recombinant US9 protein be integrated into serological tests to improve differential diagnosis of EHV-1 versus EHV-4 infections?

Integrating recombinant US9 protein into serological tests could significantly enhance the differential diagnosis of EHV-1 versus EHV-4 infections, addressing a critical need in equine veterinary medicine. The following methodological approaches offer promising avenues:

  • Type-Specific ELISA Development:

    • Antigen Selection: Utilize recombinant fragments of US9 focusing on regions with greatest sequence divergence between EHV-1 and EHV-4 US9 proteins (which share only 50% identity ).

    • Assay Design:

      • Develop parallel plate assays coated with either EHV-1 or EHV-4 US9 recombinant proteins

      • Calculate differential binding ratios to distinguish type-specific responses

      • Implement cut-off values based on known positive and negative controls

    • Validation Strategy: Test against sera from experimental infections with known virus type and against field samples with PCR-confirmed diagnoses

  • Multiplex Bead-based Immunoassays:

    • Technology Platform: Luminex or similar bead-based systems

    • Methodology:

      • Couple different US9 fragments to spectrally distinct beads

      • Include both type-specific and cross-reactive fragments

      • Simultaneously test for multiple antibody specificities in a single sample

      • Use machine learning algorithms to analyze binding patterns for superior discrimination

    • Advantage: Higher throughput and lower sample volume requirements than traditional ELISA

  • Lateral Flow Devices for Point-of-Care Testing:

    • Design: Incorporate recombinant US9 type-specific epitopes into rapid immunochromatographic assays

    • Implementation:

      • Use gold nanoparticles conjugated to US9 fragments

      • Include control line plus separate test lines for EHV-1 and EHV-4 specific antibodies

      • Develop smartphone-based readers for quantitative assessment

    • Application: Ideal for field-based testing during outbreaks

  • Combination with Existing Tests:

    • Integrate with gG-based Discrimination: Combine US9 testing with the current gold standard that uses glycoprotein G (gG1 and gG4) for virus type discrimination

    • Complementary Approach:

      • Implement testing algorithms that incorporate results from both gG and US9 assays

      • Improve diagnostic accuracy through multiple independent type-specific markers

      • Account for varying individual responses to different viral antigens

  • Serial Testing Strategy:

    • Primary Screening: Use current gG-based ELISA for initial type determination

    • Secondary Confirmation: Apply US9-based tests for samples with inconclusive or borderline results

    • Resolution Protocol: For continued ambiguous results, implement domain-specific LIPS assays similar to those developed for gD1

Comparative performance data based on similar approaches with other EHV-1 antigens suggests the following expectations:

Assay TypeSensitivitySpecificityTime to ResultSample RequirementsField Applicability
US9 ELISAHighModerate-High3-4 hours50-100 μL serumLaboratory-based
Multiplex Bead AssayVery HighHigh2-3 hours10-25 μL serumAdvanced laboratory
Lateral FlowModerateModerate-High15-30 minutes10-20 μL serum/bloodField-ready
Combined AlgorithmVery HighVery HighVariableMultiple samplesLaboratory-based

The successful discriminatory approach demonstrated with gD1 fragments using LIPS assays provides a methodological template that could be adapted for US9, potentially offering enhanced type-specific diagnosis given the lower sequence identity between EHV-1 and EHV-4 US9 proteins compared to some other viral antigens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.