Recombinant Equine herpesvirus 1 Glycoprotein gp2 (EUs4)

Shipped with Ice Packs
In Stock

Description

Role in EHV-1 Pathogenesis

Research highlights gp2's contributions to viral virulence and immune interactions:

  • Cell-to-Cell Spread: Deletion of gp2 in EHV-1 strains (e.g., KyA) reduces extracellular virus titers by 6-fold and plaque diameters by 13% .

  • Immunopathology: Recombinant KyA expressing full-length RacL11 gp2 (KyARgp2F) induces fatal lung inflammation in CBA mice, characterized by:

    • 20% body weight loss by day 3 post-infection .

    • Upregulation of cytokines (IL-1β, IL-6, TNF-α) and chemokines (MIP-1α, MIP-2) .

  • Vaccine Safety Concerns: Attenuated KyA lacking full-length gp2 is apathogenic, while gp2 restoration restores virulence, raising caution for vaccine design .

Comparative Genomic Insights

Genetic variations in gp2 across EHV-1 strains correlate with pathogenicity:

Straingp2 FeaturesPathogenicity
RacL11Full-length gp2 (791 aa)High virulence, severe respiratory disease
KyATruncated gp2 (383 aa due to 1,242 bp deletion)Attenuated, used in experimental vaccines
Ab4Full-length gp2 (797 aa)Pathogenic, reference strain

Applications in Research

  • Vaccine Development:

    • Truncated gp2 in KyA-based vaccines reduces immunopathology while retaining immunogenicity .

    • Full-length gp2 inclusion in vaccines risks adverse inflammatory responses .

  • Pathogenesis Studies:

    • gp2 facilitates secondary envelopment and viral egress .

    • Its O-glycosylation pattern may influence immune evasion .

  • Diagnostic Tools:

    • Recombinant gp2 serves as an antigen for antibody detection assays .

Key Research Findings

  • Immune Activation: Full-length gp2 triggers robust chemokine expression (e.g., MIP-1α, MCP-1) within 12 hours of infection, recruiting macrophages and lymphocytes to infection sites .

  • Strain-Specific Effects: While RacL11 gp2 exacerbates disease, its deletion in Ab4 reduces pulmonary pathology in mice .

  • Structural Determinants: The cysteine-rich C-terminal domain is critical for membrane anchoring, whereas the N-terminal glycosylation modulates host interactions .

Future Directions

  • Vaccine Optimization: Engineered gp2 variants lacking immunopathological domains may balance safety and efficacy.

  • Mechanistic Studies: Elucidating gp2’s role in viral envelopment and monocyte-mediated systemic spread .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped on blue ice unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize your request.
Synonyms
EUs4; 71; Glycoprotein gp2; Glycoprotein X; GpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-797
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)
Target Names
EUs4
Target Protein Sequence
TETTTSSSSTSGSGQSTSSGTTNSSSSPTTSPPTTSSSPPTSTHTSSPSSTSTQSSSTAA TSSSAPSTASSTTSIPTSTSTETTTTTPTASTTTPTTTTAAPTTAATTTAVTTAASTSAE TTTATATATSTPTTTTPTSTTTTTATTTVPTTASTTTDTTTAATTTAATTTAATTTAATT TAATTTAATTTAATTTAATTSSATTAATTTAATTTAATTTAATTTAATTTAATTTGSPTS GSTSTTGASTSTPSASTATSATPTSTSTSAAATTSTPTPTSAATSAESTTEAPTSTPTTD TTTPSEATTATTSPESTTVSASTTSATTTAFTTESHTSPDSSTGSTSTAEPSSTFTLTPS TATPSTDQFTGSSASTESDSTDSSTVPTTGTESITESSSTTEASTNLGSSTYESTEALET PDGNTTSGNTTPSPSPRTPSFADTQQTPDNGVSTQHTTINDHTTANAQKHAGHHRGRAGG RRGSPQGGSHTTPHPDRLTPSPDDTYDDDTNHPNGRNNSIEIVPQLPPDRPIIELGVATL RKNFMEASCTVETNSGLAIFWKIGNASVDAFNRGTTHTRLMRNGVPVYALVSTLRVPWLN VIPLTKITCAACPTNLVAGDGVDLNSCTTKSTTIPCPGQQRTHIFFSAKGDRAVCITSEL VSQPTITWSVGSDRLRNDGFSQTWYGIQPGVCGILRSEVRIHRTTWRFGSTSKDYLCEVS ASDSKTSDYKVLPNAHSTSNFALVAATTLTVTILCLLCCLYCMLTRPRASVY
Uniprot No.

Target Background

Function
Virulence factor.
Database Links

KEGG: vg:2948560

Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is Equine Herpesvirus 1 (EHV-1) glycoprotein gp2 and how is it classified within viral proteins?

Equine herpesvirus 1 (EHV-1) glycoprotein gp2 is a viral envelope protein encoded by gene 71 (also known as EUs4) in the EHV-1 genome. It is one of the most abundant and immunogenic glycoproteins found in EHV-1 virions . EHV-1 belongs to the Varicellovirus genus within the Alphaherpesvirinae subfamily, and is one of the most prevalent viruses affecting equine populations worldwide . Unlike other alphaherpesviruses that typically express a conserved set of glycoproteins (gB, gC, gD, gE, gG, gH, gI, gK, gL, and gM), EHV-1 encodes additional glycoproteins including gp2 . Homologues of gp2 are found in EHV-1, EHV-4, and asinine herpesvirus 3, making it relatively unique to equine herpesviruses .

What are the key structural characteristics of EHV-1 gp2?

EHV-1 gp2 is a heavily O-glycosylated protein characterized by high serine and threonine content. The structural features include:

  • Molecular mass ranging from 192 to >400 kDa in virulent strains, with most expressing a 250 kDa form

  • Rich in serine and threonine residues, sites for extensive O-glycosylation

  • Undergoes partial cleavage in infected cells into two polypeptides

  • Cleavage occurs after two adjacent arginine residues at positions 506 and 507 in the sequence HRGRAGGR

  • In attenuated strains like KyA, a truncated form of approximately 75-80 kDa exists due to an in-frame deletion of 1,242 nucleotides in gene 71

This complex glycoprotein structure differs significantly between virulent and attenuated EHV-1 strains, suggesting its structural conformation may influence viral pathogenicity .

What experimental methods are used to detect gp2 expression in infected cells?

Researchers employ several complementary techniques to detect and characterize gp2 expression:

  • Western blot analysis: Using antibodies specific to gp2, this technique allows differentiation between full-length (250 kDa) and truncated (75-80 kDa) forms

  • PCR and genomic analysis:

    • PCR using primers specific to gene 71 (such as gp2-1 and gp2-2) can distinguish between full-length gene (2.4 kbp product) and truncated gene (1.14 kbp product)

    • Restriction enzyme analysis with enzymes like BamHI, HindIII, or EcoRI followed by agarose gel electrophoresis can confirm genomic alterations

  • Southern blot analysis: Using labeled probes (like pHA2 or p71) to confirm the correct insertion of full-length or truncated gp2 genes

  • Virus culture and fluorescence detection: For recombinant viruses expressing fluorescent-tagged gp2 or GFP markers, direct visualization using fluorescence microscopy can confirm expression

  • Flow cytometry: Used for quantitative analysis, particularly when working with fluorescent protein-tagged constructs

How are recombinant forms of EHV-1 gp2 typically generated for research?

Generation of recombinant EHV-1 expressing different forms of gp2 involves several sophisticated molecular techniques:

  • Bacterial Artificial Chromosome (BAC) technology:

    • The complete viral genome is maintained as a BAC in E. coli

    • Gene 71 (encoding gp2) is manipulated through site-directed mutagenesis

    • Modified BAC DNA is transfected into mammalian cells (often RK-13 cells) to produce infectious virus

  • Co-transfection approach:

    • Cells are co-transfected with BAC DNA and a plasmid containing the desired gp2 variant

    • For example, pAb4_CMV_GFP BAC DNA and plasmid p71Ab4 can be co-transfected to restore gp2 expression

  • Plaque purification:

    • Multiple rounds of plaque purification ensure a homogeneous population of the recombinant virus

  • Validation methods:

    • Restriction enzyme analysis to confirm genetic modifications

    • PCR amplification of the gp2 gene region

    • Southern blotting with specific probes

    • Expression analysis by Western blotting

These approaches have enabled the creation of defined mutants like RacL11Δgp2, L11Rgp2F, L11Rgp2T, KyAΔgp2, KyARgp2T, and KyARgp2F for comparative functional studies .

What are the functional differences between full-length and truncated forms of gp2?

Research using recombinant viruses has revealed significant functional differences between the full-length (250 kDa) and truncated (75-80 kDa) forms of gp2:

ParameterFull-length gp2 (250 kDa)Truncated gp2 (75-80 kDa)
Virus ProductionHigher titersLower titers
Extracellular VirusSignificantly more efficientLess efficient (27-51 fold reduction compared to full-length)
Cell-associated VirusModerately more efficientLess efficient (5-9 fold reduction)
Functional ReplacementCannot fully function in KyA backgroundCannot fully replace full-length in RacL11 background
Post-translational ProcessingUndergoes partial cleavageLikely cannot undergo normal cleavage due to deletion
Virulence AssociationAssociated with virulent strains (RacL11)Associated with attenuated strains (KyA)

These differences indicate that the two forms are not functionally equivalent and cannot compensate for each other's actions when expressed in allogeneic virus backgrounds . This suggests that specific structural elements of gp2, modified by the substantial deletion in attenuated strains, are essential for its complete functionality.

How does gp2 contribute to EHV-1 replication and pathogenesis?

The contribution of gp2 to EHV-1 replication and pathogenesis is multifaceted:

  • Virus Replication Efficiency:

    • Deletion of gp2 reduces virus titers, particularly of extracellular virus

    • In RacL11-background viruses, gp2-negative mutants show 2-6 fold reduction in both cell-associated and extracellular titers

    • In KyA-background viruses, absence of gp2 results in 5-9 fold reduction for cell-associated virus and 27-51 fold reduction for extracellular virus

  • Pathogenesis Effects:

    • Natural EHV-1 infection can cause respiratory disorders, abortion, neonatal foal death, myeloencephalopathy, and chorioretinopathy

    • Studies in experimental horses show that virulent strains with full-length gp2 can lead to severe manifestations including Equine Herpesvirus Myeloencephalopathy (EHM)

    • Histopathological studies show that virulent strains can cause lymphohistiocytic vasculitis and lymphocytic infiltrates in lungs, spinal cord, endometrium, and eyes

  • Complex Relation to Virulence:

    • Simply replacing truncated gp2 with full-length gp2 in attenuated strains does not fully restore virulence

    • Similarly, introducing truncated gp2 into virulent strains does not completely attenuate them

    • This indicates gp2 works in concert with other viral factors to determine pathogenicity

These findings suggest gp2 plays important roles in virus production, release, and potentially in tissue tropism, but is not the sole determinant of virulence .

What methodological challenges exist in studying recombinant gp2 function in vitro and in vivo?

Researchers face numerous technical challenges when investigating recombinant gp2:

  • In Vitro Challenges:

    • The large size (250 kDa) and extensive glycosylation make expression and purification technically demanding

    • Mammalian expression systems are required for proper post-translational modifications

    • Limited availability of equine cell lines that recapitulate the in vivo cellular environment

    • Difficulty in developing functional assays for a protein whose precise roles remain incompletely defined

  • In Vivo Challenges:

    • Horses are the natural hosts, making experiments expensive and logistically complex

    • Ethical considerations limit extensive in vivo experimentation

    • The specific contribution of gp2 to pathogenesis may differ between experimental models and natural hosts

    • Multi-organ involvement in EHV-1 pathogenesis complicates tissue-specific analysis

  • Technical Obstacles:

    • Creating and validating recombinant viruses is time-consuming

    • Ensuring genetic modifications affect only gp2 without unintended effects

    • Specialized reagents for equine studies may be less readily available

    • Complex post-translational modifications are difficult to replicate in expression systems

  • Approaches to Overcome Challenges:

    • Use of bacterial artificial chromosome (BAC) technology for precise genetic manipulation

    • Development of fluorescently tagged viruses for tracking in vitro and in vivo

    • Comparative studies using different recombinant viruses in the same experimental system

    • Multi-technique validation approaches (PCR, Southern blot, restriction analysis)

These challenges necessitate sophisticated experimental designs and careful interpretation of results when studying gp2 function.

How do post-translational modifications affect gp2 structure and function?

Post-translational modifications significantly impact gp2 structure and function:

  • O-Glycosylation:

    • gp2 is heavily O-glycosylated, contributing to its large apparent molecular weight

    • Glycosylation occurs on serine and threonine residues, which are abundant in gp2

    • These modifications likely affect:

      • Protein stability and protection from proteolytic degradation

      • Proper protein folding and tertiary structure

      • Interactions with cellular receptors or other viral proteins

      • Potential shielding from neutralizing antibodies

  • Proteolytic Cleavage:

    • EHV-1 gp2 undergoes partial cleavage in infected cells

    • Cleavage occurs after two adjacent arginine residues at positions 506 and 507

    • This processing may activate or regulate gp2 function

    • The truncated form in KyA likely cannot undergo this cleavage due to the deletion

  • Structural Consequences:

    • The molecular mass of full-length gp2 ranges from 192 to >400 kDa, far exceeding its predicted size based on amino acid sequence alone

    • This discrepancy reflects the extensive addition of carbohydrate moieties

    • The truncated form (75-80 kDa) in KyA strain has different glycosylation patterns

These modifications profoundly influence gp2 structure and likely its interactions with host and viral factors, potentially explaining the functional differences between full-length and truncated forms .

What role might gp2 play in the development of vaccines against EHV-1?

Due to its immunogenic properties, gp2 holds significant potential for EHV-1 vaccine development:

  • Immunogenic Properties:

    • gp2 is among the most abundant and immunogenic glycoproteins in EHV-1 virions

    • As a surface-exposed protein, it represents a target for neutralizing antibodies

    • The protein likely contains multiple T-cell epitopes that could stimulate cellular immunity

  • Recombinant Vaccine Approaches:

    • Recombinant gp2 could serve as an antigen in subunit vaccines

    • The gene encoding gp2 could be incorporated into viral vectors

    • Live attenuated vaccines could be designed with modified forms of gp2 that maintain immunogenicity while reducing virulence

    • Different forms (full-length vs. truncated) could be evaluated for optimal protective immunity

  • Considerations for Vaccine Development:

    • The complex glycosylation of gp2 necessitates expression systems that recapitulate these modifications

    • Proper folding and epitope presentation are essential for inducing protective antibodies

    • The relationship between different forms of gp2 and protection needs thorough investigation

    • Recombinant viruses expressing modified gp2 could serve as potential vaccine candidates

  • Research Applications:

    • Studying immune responses to different forms of recombinant gp2 can identify protective epitopes

    • Serum neutralization (SN) titers against recombinant viruses can assess vaccine efficacy

    • Fluorescently tagged recombinant viruses allow tracking of infection in vaccinated animals

Despite its potential, the complex relationship between gp2 and virulence highlights the need for careful evaluation of any gp2-based vaccine approach to ensure both safety and efficacy .

What techniques are used to confirm the genetic integrity of recombinant EHV-1 expressing modified gp2?

Multiple complementary approaches ensure the genetic integrity of recombinant EHV-1 expressing modified forms of gp2:

  • Restriction Enzyme Analysis:

    • Viral DNA is digested with restriction enzymes such as BamHI, HindIII, or EcoRI

    • The resulting fragments are separated by agarose gel electrophoresis

    • Fragment patterns are compared with those of parental strains and predicted patterns based on known sequence modifications

  • PCR Verification:

    • PCR using primers targeting gene 71 (e.g., gp2-1 and gp2-2)

    • Full-length gp2 gene yields a 2.4 kbp product

    • Truncated gp2 gene produces a 1.14 kbp product

    • gp2-negative constructs yield no amplification product

  • Southern Blot Analysis:

    • Digested viral DNA is transferred to membranes and probed with labeled DNA fragments

    • Probes like pHA2 or p71 can confirm the presence and correct size of the gp2 gene

    • This technique verifies both presence and location of the inserted gene

  • DNA Sequencing:

    • Direct sequencing of the modified region confirms the exact nucleotide sequence

    • Ensures no unintended mutations were introduced during recombination

  • Expression Verification:

    • Western blot analysis confirms expression of the correct size protein

    • Detection of 250 kDa protein indicates full-length gp2

    • Detection of 75-80 kDa protein indicates truncated gp2

These rigorous validation steps ensure that phenotypic differences observed in experiments with recombinant viruses can be confidently attributed to the specific gp2 modifications.

How do researchers quantify differences in replication between EHV-1 strains expressing different forms of gp2?

Researchers employ multiple quantitative assays to compare replication of EHV-1 strains expressing different forms of gp2:

  • Virus Titration Assays:

    • Plaque assays quantify infectious virus particles

    • Cell-associated virus titers measure virus retained within or attached to cells

    • Extracellular virus titers measure released virus in culture supernatants

    • Studies show 2-6 fold reductions in RacL11-background gp2-negative viruses

    • More dramatic reductions (5-9 fold for cell-associated; 27-51 fold for extracellular) in KyA-background gp2-negative viruses

  • Growth Kinetics Analysis:

    • Multiple time-point sampling tracks virus production over time

    • Growth curves allow comparison of replication rates and maximum titers

    • Statistical analysis quantifies significant differences between strains

  • Quantitative PCR:

    • Real-time PCR quantifies viral genome copies

    • Distinguishes between differences in infectivity versus particle production

  • In Vivo Quantification:

    • Nasal shedding measurement through swab collection and titration

    • Viremia assessment through isolation from peripheral blood mononuclear cells (PBMCs)

    • Flow cytometry detection of fluorescently tagged viruses in blood cells

  • Fluorescence-Based Tracking:

    • For GFP-expressing recombinant viruses, direct visualization and quantification

    • Fluorescent plaques can be counted to determine infectious titers

    • Fluorescent fundus photography (FFP) can track virus in ocular tissues in vivo

These quantitative approaches provide comprehensive assessment of how different forms of gp2 impact various aspects of the viral replication cycle .

What experimental models are most appropriate for studying EHV-1 gp2 function in pathogenesis?

Several experimental models offer insights into EHV-1 gp2 function in pathogenesis, each with specific advantages:

  • In Vitro Cell Culture Systems:

    • RK-13 cells: Rabbit kidney cells frequently used for EHV-1 propagation and titration

    • Equine dermal cells (NBL6): More physiologically relevant for studying effects in equine cells

    • Primary equine endothelial cells: Important for studying vascular pathogenesis

  • Ex Vivo Tissue Models:

    • Equine respiratory epithelial explants: Allows study of initial infection events

    • Vascular tissue explants: Useful for examining endothelial infection and damage

  • Animal Models:

    • Horses: Natural host providing most physiologically relevant model

      • Allows assessment of respiratory disease, viremia, neurological disease

      • Enables study of specific pathologies like vasculitis in CNS and chorioretinitis

      • Permits investigation of gp2's role in reproductive pathology

    • Small animal models: More practical for initial screening

      • Although less physiologically relevant, useful for preliminary studies

  • Specialized In Vivo Approaches:

    • Fluorescent fundus photography (FFP): For tracking GFP-expressing viruses in the equine ocular fundus vascular network

    • Histopathological examination: Reveals tissue-specific effects

      • Studies show EHV-1 can cause lymphohistiocytic vasculitis and lymphocytic infiltrates in various tissues

      • Can detect EHV-1 antigen in tissues like eyes, spinal cord, and reproductive organs

  • Comprehensive Assessment Parameters:

    • Clinical examination scores

    • Virological parameters (nasal shedding, viremia)

    • Serological responses (serum neutralization titers)

    • Tissue-specific pathology

    • Virus antigen distribution in tissues

The equine model remains the gold standard for studying EHV-1 pathogenesis, as it allows observation of the full spectrum of disease manifestations and evaluation of gp2's role in tissue-specific pathology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.