Recombinant Equine herpesvirus 1 Glycoprotein gp2 (US4)

Shipped with Ice Packs
In Stock

Description

General Information

  • Expression and Location Most EHV-1 strains encode a large glycoprotein, gp2 (250 kDa), which is expressed from gene 71 . The EUs4 gene maps within the unique short (Us) genomic segment .

  • Homologues Homologues of gp2 are present in EHV-1, EHV-4, and asinine herpesvirus 3 .

  • Characteristics EHV-1 gp2 is rich in serine and threonine residues and is heavily O-glycosylated, with a molecular mass ranging from 192 to greater than 400 kDa .

  • Cleavage EHV-1 glycoprotein can be cleaved into two polypeptides in infected cells, in contrast to EHV-4 gp2 . Endoproteolytic cleavage happens after two adjacent arginine (R) residues at positions 506 and 507 in the sequence HRGRAGGR, resulting in a 42-kDa carboxy-terminal subunit that contains the transmembrane anchor, and an N-terminal serine/threonine-rich component that is highly O-glycosylated . The protein is separated into a cysteine-rich 42-kDa C-terminal subunit containing the transmembrane anchor sequence and a serine/threonine-rich N-terminal region that is highly glycosylated with O-linked carbohydrates .

  • Function Although gp2 is not essential for virus growth in cell culture or in the mouse, its deletion impairs virus cell-to-cell spread and readsorption .

Role in Pathogenesis and Immunity

  • Immune Response Glycoprotein gp2 is among the most abundant and immunogenic glycoproteins in EHV-1 and EHV-4 virions .

  • Leukocyte Recruitment EHV-1 glycoproteins gG and gp2 control the recruitment of leukocytes to the horse’s respiratory tract. Glycoprotein gp2 has chemokine-binding activities that impede the migration of immune cells .

Impact of Truncated gp2

  • KyA Strain The avirulent strain KyA has an in-frame deletion of 1,242 nucleotides in gene 71, in addition to other changes in the viral genome .

  • Expression Cells infected with RacL11 virus or a mutant KyA virus harboring full-length gene 71 express a 250-kDa gp2, whereas cells infected with KyA or mutant RacL11 virus expressing KyA gp2 express a 75- to 80-kDa gp2 .

  • Virulence Expression of full-length gp2 derived from the virulent strain RacL11 by strain KyA was insufficient to restore virulence in the BALB/c mouse model of infection . Deletion of gp2 in the virulent strain RacL11 resulted in a recombinant virus that exhibited residual virulence, because a significant loss of body weight was observed in animals injected with gp2-negative RacL11 .

ELISA Development

  • EHV-4 Specificity A major B-cell epitope in the type-specific region of EHV-4 was identified and applied as an antigen in enzyme-linked immunosorbent assays (ELISAs) . A 24-amino-acid repeat sequence expressed as a glutathione S-transferase fusion protein specifically reacted as well as the type-specific region with sera from foals infected with EHV-4 .

  • Peptide Identification The 12-mer peptide MKNNPIYSEGSL contained a major B-cell epitope specific for EHV-4 infection. Inclusion of this 12-mer peptide in ELISAs for an epidemiological study specifically detected EHV-4 infection in the field .

  • Application ELISAs with peptide G1 were applied to the diagnosis of EHV-4 infection using paired sera from seven horses with pyrexia due to EHV-4 infection in the field. The amount of antibodies specific for G1 significantly increased during the convalescent phase (P < 0.001) .

Functional Studies and Mutant Viruses

  • Cell-to-cell spread Deletion of gp2 impairs virus cell-to-cell spread, readsorption, and secondary envelopment .

  • Attenuation Deletion of gene 71 in EHV-1 strain Ab4 resulted in attenuation, and the generated virus mutant used as an experimental vaccine conferred protection against pulmonary disease in mice after challenge with wild-type virus .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
US4; 71; Glycoprotein gp2; Glycoprotein X; GpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-383
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 1 (strain Kentucky A) (EHV-1) (Equine abortion virus)
Target Names
US4
Target Protein Sequence
TETTTSSSSTSGSGQSTSSGTTNSSSSPTTSPPTTSSSPPTSTHTSSPSTANAQKHAGHH RGRAGGRRGSPQGGSHTTPHPDRLTPSPDDTYDDDTNHPNGRNNSIEIVPQLPPDRPIIE LGVATLRKNFMEASCTVETNSDLAIFWKIGKPSVDAFNRGTTHTRLMRNGVPVYALVSTL RVPWLNVIPLTKITCAACPTNLVAGDGVDLNSCTTKSTTIPCPGQQRTHIFFSAKGDRAV CITSELVSQPTITWSVGSDRLRNDGFSQTWYGIQPGVCGILRSEVRIHRTTWRFGSTSKD YLCEVSASDSKTSDYKVLPNAHSTSNFALVAATTLTVTILCLLCCLYCMLTRPRASVY
Uniprot No.

Target Background

Function
The glycoprotein gp2 from the avirulent Kentucky A (KyA) strain is likely non-functional due to a 1,242-nucleotide in-frame deletion within gene 71.
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is Equine herpesvirus 1 (EHV-1) glycoprotein gp2 (US4) and what are its basic structural characteristics?

Equine herpesvirus 1 (EHV-1) glycoprotein gp2, encoded by gene 71 (US4), is one of the most abundant and immunogenic viral glycoproteins unique to EHV-1. It is a heavily O-glycosylated protein with a molecular mass ranging from 192 to over 400 kDa in its full-length form. Unlike most other alphaherpesviruses, EHV-1 uniquely encodes gp2, with homologues found only in EHV-4 and asinine herpesvirus 3 . The glycoprotein is rich in serine and threonine residues which undergo extensive O-glycosylation, contributing significantly to its large molecular mass. In viral strains like RacL11, gp2 exists as a 250 kDa protein, while the attenuated KyA strain expresses a truncated 75-80 kDa version due to an in-frame deletion of 1,242 nucleotides in gene 71 . This structural difference has important functional implications for viral pathogenicity.

How is gp2 post-translationally processed in EHV-1 infected cells?

The post-translational processing of EHV-1 gp2 involves multiple modifications that are critical for its function. The protein undergoes extensive O-glycosylation, particularly in its serine/threonine-rich N-terminal region. Unlike its EHV-4 counterpart, EHV-1 gp2 is partially cleaved into two polypeptides in infected cells . This endoproteolytic cleavage occurs after two adjacent arginine residues at positions 506 and 507 in the sequence HRGRAGGR506R507G . The cleavage results in two distinct fragments: a 42-kDa carboxy-terminal subunit containing the transmembrane anchor, and a heavily O-glycosylated N-terminal component . This proteolytic processing appears to be important for the functional activities of gp2 during viral replication. The methodological approach to studying this process typically involves Western blot analysis with specific antibodies that can detect both the full-length protein and the cleaved products, combined with site-directed mutagenesis to modify potential cleavage sites.

What detection methods can researchers use to identify and characterize gp2 in laboratory settings?

Researchers have several methodological approaches to detect and characterize EHV-1 gp2:

  • Western Blot Analysis:

    • Monoclonal antibody 8B6, which targets the terminal region of gp2, can detect both the full-length protein and its 42-kDa cleavage product .

    • This approach allows differentiation between the 250 kDa full-length gp2 of virulent strains and the 75-80 kDa truncated form in attenuated strains like KyA .

  • PCR and DNA Sequencing:

    • Amplification and sequencing of gene 71 (US4) can identify deletions, insertions, or point mutations.

    • This is particularly useful for characterizing new isolates or confirming genetic modifications in recombinant viruses .

  • Immunofluorescence Microscopy:

    • Using fluorescently labeled antibodies against gp2 to visualize its distribution in infected cells.

    • This technique helps determine subcellular localization and trafficking patterns.

  • Glycosylation Analysis:

    • Treatment with glycosidases followed by size analysis can determine the extent and type of glycosylation.

    • Mass spectrometry can provide detailed information about specific glycosylation sites.

  • Recombinant Expression Systems:

    • Expression of tagged versions of gp2 in heterologous systems for purification and functional studies.

    • Baculovirus expression systems are often preferred due to their ability to perform complex post-translational modifications.

The choice of method depends on the specific research question, with combinations of these approaches providing the most comprehensive characterization.

What role does gp2 play in EHV-1 replication and pathogenesis?

Glycoprotein gp2 plays several critical roles in EHV-1 replication and pathogenesis. Studies using gp2-deficient viruses have demonstrated that this glycoprotein is particularly important for virus egress from infected cells, although it does not affect secondary envelopment, which occurs with unaltered kinetics and efficiency in the absence of gp2 . This indicates that gp2 functions primarily in the late stages of the viral replication cycle, facilitating the release of virions from the cell surface.

In terms of pathogenesis, deletion of gene 71 (encoding gp2) in the EHV-1 strain Ab4 resulted in viral attenuation, and when used as an experimental vaccine, this mutant conferred protection against pulmonary disease in mice after challenge with wild-type virus . This demonstrates gp2's significant contribution to virulence. Furthermore, along with glycoproteins gI and gE, full-length gp2 has been implicated in cell-to-cell spread of the virus , which is crucial for effective dissemination within the host while evading neutralizing antibodies.

The attenuated nature of the KyA strain, which expresses a truncated gp2, further supports the role of this glycoprotein in pathogenesis . Experimental evidence indicates that the full-length and truncated forms of gp2 are not functionally equivalent and cannot compensate for each other when expressed in allogeneic virus backgrounds , underscoring the importance of specific structural features of gp2 for its function in pathogenesis.

What structural differences exist between gp2 in virulent and attenuated EHV-1 strains?

Significant structural differences exist between gp2 in virulent and attenuated EHV-1 strains, which contribute to their differing pathogenic potential:

FeatureVirulent Strains (e.g., RacL11, Ab4)Attenuated Strain (KyA)
Size250 kDa full-length protein75-80 kDa truncated protein
Genetic basisComplete gene 71 sequenceIn-frame deletion of 1,242 nucleotides in gene 71
O-glycosylationExtensive, particularly in N-terminal regionReduced due to partial deletion of serine/threonine-rich regions
CleavagePartially cleaved at positions 506-507Altered processing due to structural changes
Functional capacityEfficient virus egress and cell-to-cell spreadImpaired virus egress functions

The virulent wild-type strains RacL11 and Ab4 express a full-length 250 kDa gp2 that is extensively O-glycosylated . In contrast, the attenuated KyA strain contains an in-frame deletion in gene 71, resulting in expression of a truncated 75-80 kDa gp2 . This deletion affects the serine/threonine-rich regions that normally undergo heavy O-glycosylation, contributing to the size difference between the two forms.

The functional consequences of these structural differences are significant. The full-length gp2 in virulent strains efficiently supports virus egress and cell-to-cell spread, whereas the truncated form in KyA has impaired function in these processes . Experimental studies have demonstrated that these two forms are not functionally equivalent and cannot compensate for each other's roles when expressed in allogeneic virus backgrounds , indicating that specific structural features of full-length gp2 are essential for its contribution to virulence.

What experimental approaches are used for generating recombinant EHV-1 expressing modified versions of gp2?

Generating recombinant EHV-1 expressing modified versions of gp2 requires sophisticated molecular techniques:

  • Bacterial Artificial Chromosome (BAC) Technology:

    • The EHV-1 genome is maintained as a BAC in E. coli.

    • Site-directed mutagenesis is performed to introduce specific modifications to gene 71.

    • Two-step Red recombination (en passant mutagenesis) allows for scarless modification.

    • Modified BAC DNA is transfected into eukaryotic cells to reconstitute infectious virus.

  • Homologous Recombination in Eukaryotic Cells:

    • Cells are co-transfected with parental virus DNA and a transfer plasmid containing the modified gene 71.

    • The transfer plasmid includes homologous sequences flanking the target region.

    • Selection markers (e.g., fluorescent proteins or antibiotic resistance) facilitate identification of recombinant viruses.

    • Plaque purification isolates clonal recombinant viruses.

  • Verification and Characterization Methods:

    • PCR and sequencing confirm the desired modifications.

    • Western blot analysis verifies protein expression, using antibodies like MAb 8B6 that detects the C-terminal region of gp2 .

    • Growth kinetics and plaque morphology assess functional effects.

    • Animal models evaluate pathogenicity changes.

The search results describe experiments where researchers generated recombinant viruses in which either the full-length RacL11 gp2 or the truncated KyA gp2 was expressed in heterologous virus backgrounds . These studies revealed that the full-length and truncated forms of gp2 are not functionally equivalent, as "replacement in the KyA genome of the truncated with the full-length RacL11 gene 71 did not result in the generation of virulent virus" . This methodological approach of gene swapping between virulent and attenuated strains provides valuable insights into the specific contributions of gp2 to viral pathogenesis.

How does the truncated form of gp2 in the KyA strain affect virus functionality compared to the full-length gp2 in virulent strains?

The truncated form of gp2 (75-80 kDa) expressed by the KyA strain significantly alters virus functionality compared to the full-length gp2 (250 kDa) in virulent strains like RacL11 and Ab4. Experimental studies using recombinant viruses have demonstrated that these forms are not functionally equivalent and cannot compensate for each other's roles when expressed in allogeneic virus backgrounds .

The KyA strain, which expresses the truncated gp2, is attenuated in both mice and horses, whereas RacL11 with full-length gp2 causes severe respiratory disease and high mortality in mice . This difference in pathogenicity is partly attributable to the functional differences between the two forms of gp2. The truncated form affects several aspects of viral functionality:

  • Virus Egress: Viruses expressing truncated gp2 show impaired ability to exit infected cells, although secondary envelopment occurs with normal efficiency . This suggests that the N-terminal glycosylated portion of gp2, which is partially deleted in KyA, plays a critical role in the efficient release of virions.

  • Cell-to-Cell Spread: Full-length gp2, in conjunction with glycoproteins gI and gE, facilitates efficient cell-to-cell spread, whereas the truncated version is less effective in this process . This difference contributes to reduced tissue dissemination and pathogenicity.

  • Host Interactions: The structural differences may alter how the virus interacts with host cell factors and immune components, potentially affecting immune evasion mechanisms.

Interestingly, despite these functional differences in vivo, the KyA strain "replicates to high titers in cell culture as compared to RacL11 and Ab4" . This indicates that the truncated gp2 does not impair basic replication capacity in vitro across multiple cell types of mouse, rabbit, equine, or human origin. The attenuation observed in vivo is therefore likely related to specific host-pathogen interactions rather than intrinsic replicative capacity.

How do mutations in gp2 contribute to virus attenuation and what are the implications for vaccine development?

Mutations in gp2 contribute significantly to virus attenuation and have important implications for vaccine development:

  • Deletion Mutations and Attenuation:

    • The in-frame deletion in gene 71 of the KyA strain (1,242 nucleotides) results in a truncated gp2 (75-80 kDa) that contributes to its attenuated phenotype .

    • Complete deletion of gene 71 in the Ab4 strain resulted in attenuation while maintaining immunogenicity, allowing it to confer protection against challenge with wild-type virus .

  • Mechanisms of Attenuation:

    • Impaired virus egress: Mutations in gp2 reduce the efficiency of virion release from infected cells .

    • Reduced cell-to-cell spread: Modified gp2 affects the virus's ability to spread directly between adjacent cells, limiting tissue dissemination .

    • Altered virion composition: Changes in gp2 may affect the incorporation of other viral proteins into virions.

  • Vaccine Development Applications:

    • Live-attenuated vaccines: Strains with modified gp2, like KyA or gene 71-deleted Ab4, show promise as vaccine candidates due to their attenuated virulence while maintaining immunogenicity .

    • Deletion of gene 71 in EHV-1 strain Ab4 "resulted in attenuation, and the generated virus mutant used as an experimental vaccine conferred protection against pulmonary disease in mice after challenge with wild-type virus" .

    • This approach represents a rational attenuation strategy that can be applied to vaccine development.

  • Considerations for Vaccine Design:

    • Balancing attenuation with immunogenicity: The ideal vaccine strain should be sufficiently attenuated to prevent disease while maintaining enough replication to induce robust immunity.

    • Genetic stability: Attenuating mutations should be stable to prevent reversion to virulence.

    • Cross-protection: Modified gp2 vaccines should ideally protect against multiple EHV-1 strains.

The natural attenuation of the KyA strain, which lacks not only full-length gp2 but also glycoproteins gI and gE, provides a model for multi-target attenuation strategies that could be refined for future vaccine development . Understanding the specific contributions of gp2 modifications to attenuation allows for more precise and rational vaccine design.

What are the challenges in expressing full-length recombinant gp2 in heterologous expression systems?

Expressing full-length recombinant gp2 in heterologous systems presents several significant challenges for researchers:

  • Size and Structural Complexity:

    • The full-length gp2 is a large protein (250 kDa) with extensive post-translational modifications .

    • The heavy O-glycosylation pattern requires eukaryotic expression systems with appropriate glycosylation machinery.

    • The protein's size makes it difficult to achieve efficient expression and purification.

  • Post-translational Processing:

    • Proper O-glycosylation of the serine/threonine-rich regions is crucial for authentic structure and function .

    • The partial endoproteolytic cleavage at positions 506 and 507 may not occur correctly in heterologous systems .

    • Different cell types may produce variations in glycosylation patterns.

  • Expression System Limitations:

    • Bacterial systems lack glycosylation machinery and are unsuitable for full-length gp2.

    • Yeast systems may produce hyperglycosylated proteins with non-native patterns.

    • Insect cell systems (baculovirus) may not fully replicate mammalian glycosylation.

    • Mammalian cell systems are preferred but typically yield lower expression levels.

  • Purification Complexities:

    • The large size and heterogeneous glycosylation complicate chromatographic separation.

    • The transmembrane domain in the C-terminal region requires detergent extraction.

    • Maintaining protein stability during purification is challenging due to its complex structure.

  • Functional Assessment Challenges:

    • Verifying that recombinant gp2 retains its native conformation and functionality is difficult.

    • In vitro assays may not fully replicate the in vivo environment where gp2 functions.

    • The lack of well-characterized binding partners or enzymatic activities makes functional validation challenging.

These challenges explain why many studies focus on truncated versions of gp2 or use virus-based expression systems rather than attempting to express the full-length protein in heterologous systems. The studies in the search results primarily used recombinant viruses expressing different forms of gp2 rather than purified recombinant protein , likely due to these expression challenges.

How can researchers assess the immunogenicity of recombinant gp2 proteins for vaccine development?

Assessing the immunogenicity of recombinant gp2 proteins for vaccine development requires a comprehensive methodological approach:

  • Animal Model Selection and Experimental Design:

    • Mice models provide initial immunogenicity assessment and allow for challenge experiments with EHV-1 .

    • The search results indicate that deletion of gene 71 in EHV-1 strain Ab4, when used as an experimental vaccine, "conferred protection against pulmonary disease in mice after challenge with wild-type virus" .

    • Horses represent the natural host and should be used for confirmatory studies despite higher costs and logistical challenges.

    • Control groups should include animals immunized with adjuvant alone, irrelevant proteins, and positive controls like attenuated virus strains.

  • Antibody Response Analysis:

    • ELISA assays measuring gp2-specific antibody titers in serum from vaccinated animals.

    • Virus neutralization assays to determine if antibodies can inhibit infection.

    • Western blot analysis to confirm antibody specificity and identify immunodominant epitopes.

    • Comparison of responses against full-length versus truncated gp2 to identify critical epitopes.

  • Cellular Immune Response Evaluation:

    • ELISpot assays to enumerate T-cells responding to gp2 epitopes.

    • Intracellular cytokine staining to characterize T-cell polarization (Th1/Th2/Th17).

    • Adoptive transfer experiments to assess the protective capacity of gp2-specific T-cells.

    • Analysis of cytokine profiles in response to gp2 stimulation.

  • Challenge Studies:

    • Viral challenge using pathogenic EHV-1 strains like RacL11 or Ab4.

    • Monitoring clinical parameters (respiratory symptoms, fever, weight loss).

    • Quantification of viral shedding and viremia.

    • Histopathological examination of relevant tissues.

  • Data Analysis and Interpretation:

    • Statistical comparison of immune responses between different vaccine formulations.

    • Correlation analysis between specific immune parameters and protection.

    • Identification of immunological correlates of protection.

    • Assessment of the duration of protective immunity.

This systematic approach allows researchers to determine the potential of recombinant gp2 proteins as vaccine candidates and optimize their formulation for maximal efficacy. The evidence that deletion mutants lacking gp2 can confer protection suggests that while gp2 itself is important for virulence, immune responses against other viral antigens can compensate for its absence in a vaccine context .

What is the role of gp2 in cell-to-cell spread of EHV-1?

Glycoprotein gp2 plays a significant role in facilitating the cell-to-cell spread of EHV-1, a process that allows the virus to disseminate efficiently while evading neutralizing antibodies:

  • Collaborative Function with Other Glycoproteins:

    • Gp2, especially in its full-length form, works in concert with other viral glycoproteins, particularly gI and gE, to facilitate direct virus transfer between adjacent cells .

    • The search results indicate that "EHV-1 glycoproteins gI, gE, and full-length gp2 contribute to the pathogenesis of EHV-1" and are "involved in cell-to-cell spread" .

    • This collaborative function is evident from the fact that the KyA strain, which lacks gI and gE and expresses truncated gp2, shows reduced pathogenicity compared to virulent strains .

  • Structural Requirements for Cell-to-Cell Spread:

    • The heavily O-glycosylated N-terminal region of gp2, which is partially deleted in the KyA strain, appears to be critical for its cell-to-cell spread functions .

    • Post-translational modifications, including proteolytic cleavage and glycosylation, likely influence gp2's ability to facilitate direct cell-to-cell transmission.

    • The truncated form of gp2 in the KyA strain is less effective in supporting this process, contributing to attenuation .

  • Experimental Evidence:

    • Studies comparing recombinant viruses expressing either full-length or truncated gp2 have demonstrated differences in their ability to spread between cells .

    • The observation that gp2-deficient viruses are impaired in virus egress while secondary envelopment appears unaffected suggests a specific role in the late stages of the viral replication cycle that affects cell-to-cell spread .

  • Implications for Pathogenesis and Immunity:

    • Efficient cell-to-cell spread contributes to rapid viral dissemination within tissues.

    • This mode of transmission helps the virus evade antibody-mediated neutralization.

    • The reduced cell-to-cell spread capacity of viruses with truncated or deleted gp2 contributes to their attenuated phenotype and potential utility as vaccine candidates .

Understanding the precise molecular mechanisms by which gp2 facilitates cell-to-cell spread represents an important area for future research, with implications for both viral pathogenesis and the development of targeted antivirals.

What cellular factors interact with gp2 during EHV-1 infection?

Understanding the cellular factors that interact with gp2 during EHV-1 infection is crucial for elucidating its functions in viral pathogenesis. Based on the available research and knowledge of similar viral glycoproteins:

  • Cytoskeletal Components:

    • Gp2 likely interacts with elements of the cellular cytoskeleton during viral egress.

    • These interactions may involve actin filaments and microtubules that facilitate transport of virions to the cell surface.

    • The impairment of virus egress in gp2-deficient strains suggests these interactions are functionally important .

  • Membrane Trafficking Machinery:

    • Proteins involved in vesicular transport pathways likely associate with gp2.

    • Components of the ESCRT (Endosomal Sorting Complexes Required for Transport) machinery could be involved in gp2-mediated virus release.

    • Rab GTPases, which regulate membrane trafficking, may interact with gp2 during virion transport.

  • Glycosylation Enzymes:

    • Given its heavy O-glycosylation, gp2 interacts extensively with cellular O-glycosyltransferases .

    • These enzymes add various sugar moieties to the serine/threonine-rich regions of gp2.

    • The pattern of glycosylation may influence gp2's stability, transport, and functions.

  • Proteolytic Enzymes:

    • The endoproteolytic cleavage of gp2 involves cellular proteases that recognize the specific cleavage site HRGRAGGR506R507G .

    • These proteases are likely members of the proprotein convertase family, such as furin.

  • Junctional Proteins:

    • During cell-to-cell spread, gp2 may interact with components of cellular junctions.

    • These interactions could facilitate the formation of virological synapses for direct virus transfer.

  • Immune System Components:

    • As an abundant virion glycoprotein, gp2 likely interacts with components of the host immune system.

    • These may include pattern recognition receptors of the innate immune system.

    • Antibodies targeting gp2 have been identified, suggesting it is recognized by the adaptive immune system .

The search results do not provide explicit information about cellular interaction partners of gp2, indicating this remains an area for further research. Methodological approaches to identify these interactions could include pull-down assays, co-immunoprecipitation, proximity labeling methods, or yeast two-hybrid screens using fragments of gp2 as bait. Identifying these interactions would provide valuable insights into gp2's roles in viral replication and pathogenesis.

How do variations in gp2 between different EHV-1 strains correlate with differences in viral pathogenicity?

Variations in gp2 between different EHV-1 strains show significant correlation with differences in viral pathogenicity:

This correlation between gp2 variations and pathogenicity has important implications for understanding EHV-1 virulence mechanisms and developing attenuated vaccines. The fact that gene 71-deleted Ab4 provides protection against challenge suggests that rational modification of gp2 represents a viable strategy for vaccine development .

What methodological approaches are most effective for studying the contribution of gp2 to EHV-1 pathogenesis?

Studying the contribution of gp2 to EHV-1 pathogenesis requires integrated methodological approaches spanning molecular virology, cell biology, and in vivo models:

  • Reverse Genetics Approaches:

    • Generation of recombinant viruses with specific modifications to gene 71 (US4) .

    • This includes complete deletions, targeted mutations, and domain swapping between different strains.

    • BAC technology or homologous recombination can be used to create these mutants.

    • The search results describe experiments where researchers generated recombinant viruses expressing either full-length RacL11 gp2 or truncated KyA gp2 in allogeneic virus backgrounds .

  • In Vitro Cellular Models:

    • Comparative growth kinetics in different cell types to assess replication efficiency.

    • The search results mention experiments using equine dermis (NBL6), rabbit kidney (RK-13), human epithelial kidney (HEK293), and mouse lung epithelial (MLE12) cells .

    • Plaque size and morphology analysis to evaluate cell-to-cell spread capacity.

    • Viral egress assays to quantify virion release from infected cells.

    • Live-cell imaging to visualize gp2 trafficking and virus movement between cells.

  • Animal Models:

    • Mouse models for initial pathogenesis studies and evaluation of respiratory disease.

    • The search results describe mice infected with RacL11 "succumbed by 3-6 days post-infection," while KyA is attenuated .

    • Equine models for studies in the natural host, assessing clinical disease, viremia, and viral shedding.

    • Immunological analysis to determine host responses to different gp2 variants.

  • Molecular and Biochemical Techniques:

    • Proteomic approaches to identify cellular interaction partners of gp2.

    • Structural studies of full-length and truncated gp2 to understand functional differences.

    • Glycan analysis to characterize post-translational modifications.

  • Data Integration and Systems Approaches:

    • Transcriptomic analysis to compare host responses to viruses with different gp2 variants.

    • Computational modeling of gp2 structure-function relationships.

    • Network analysis to place gp2 within the context of virus-host interactions.

The most effective strategy combines these approaches to provide complementary perspectives on gp2's role in pathogenesis. The search results demonstrate how researchers have used recombinant viruses to study the specific contributions of gp2 variants to virus function and virulence in both cell culture and animal models .

How might structural and functional knowledge of gp2 be translated into novel therapeutic strategies against EHV-1?

Structural and functional knowledge of gp2 offers several promising avenues for developing novel therapeutic strategies against EHV-1:

  • Targeted Antiviral Development:

    • Small molecule inhibitors targeting the endoproteolytic cleavage site HRGRAGGR506R507G could prevent the functional processing of gp2.

    • Compounds interfering with O-glycosylation of gp2 could disrupt its structure and function.

    • Peptide inhibitors designed to mimic specific domains of gp2 could block its interactions with cellular or viral partners.

  • Monoclonal Antibody Therapeutics:

    • Antibodies targeting functional epitopes of gp2 could neutralize the virus or impair its cell-to-cell spread.

    • The high abundance of gp2 in virions makes it an accessible target for antibody binding .

    • Therapeutic antibodies could be administered prophylactically during outbreaks or to high-risk animals.

  • Rational Vaccine Design:

    • The knowledge that gene 71-deleted Ab4 is attenuated yet protective provides a basis for developing live-attenuated vaccines.

    • Subunit vaccines incorporating specific immunogenic domains of gp2 could induce protective immunity without risk of disease.

    • DNA or RNA vaccines encoding modified versions of gp2 could induce both humoral and cellular immune responses.

  • Combination Approaches:

    • Targeting multiple viral glycoproteins simultaneously (gp2, gI, gE) might create synergistic antiviral effects .

    • Combining gp2-targeted antivirals with immune modulators could enhance viral clearance while reducing immunopathology.

  • Translational Research Strategy:

    • Initial screening of compounds in cell culture systems testing effects on viral egress and cell-to-cell spread.

    • Validation in ex vivo tissue systems such as respiratory epithelial explants.

    • Testing in mouse models before advancing to studies in horses.

    • Focus on compounds with favorable pharmacokinetic properties and minimal toxicity.

The truncated gp2 in the KyA strain provides a natural example of how modifications to this glycoprotein can attenuate the virus . This knowledge, combined with molecular understanding of gp2's structure and function, can guide the development of therapeutics that specifically target key aspects of EHV-1 pathogenesis while minimizing off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.