Recombinant Equine herpesvirus 1 Glycoprotein K (gK)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant EHV-1 gK is produced by expressing the UL53 gene (homologous to herpes simplex virus type 1 [HSV-1] UL53) in heterologous systems such as E. coli. The protein is typically fused with tags like green fluorescent protein (GFP) or polyhistidine (His-tag) to facilitate purification, localization studies, and functional assays . Its production enables researchers to investigate gK's role in viral replication, membrane fusion, and cell-to-cell spread without the need for live virus propagation .

Role in Viral Replication and Pathogenesis

  • Growth Defects: Deletion of gK in EHV-1 strain RacH (HDeltagK) reduces infectious progeny titers by ~100-fold and decreases plaque size by 90%, underscoring its necessity for efficient replication .

  • Membrane Fusion: gK-deficient viruses fail to induce syncytia, highlighting its role in cell-cell fusion. Truncated gK-GFP partially restores fusion activity, suggesting functional redundancy in the carboxy terminus .

  • Host Entry: gK modulates viral penetration efficiency, with gK-negative viruses showing a 40% reduction in cell entry .

Applications in Research

  • Viral Entry Studies: Recombinant gK is used to dissect entry mechanisms, particularly its interaction with host receptors like MHC-I .

  • Antibody Development: The protein serves as an antigen for generating neutralizing antibodies, with applications in diagnostic assays and therapeutic research .

  • Vaccine Design: Truncated or modified gK variants are explored as candidates for attenuated vaccines, given their reduced pathogenicity and retained immunogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
gK; ORF6; Envelope glycoprotein K; Syncytial protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-343
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)
Target Names
gK
Target Protein Sequence
LHNPCVYATVSIDSKDGIAAKWEVYNSTIVYAYPENGAKRFSDGLSGFDYVCRENWVNES KLDVLKNMKELHDKVRIVVGTRNCRAYLWSVQLQMITGAWLIYIAFLCLRQERRLLGPFR NQNEFLSPTGYTFNYATYTLATTVLKTHYTKFALLLCEASLRRVALSRTFKRDPIGFLCE HSAALALIGLEVGTHFVARLLVVGTVTLVHTPCSQIYPIYLKLASWGFVVAVTIVEIVAI IYEKPPKTGSSANPPTPATHGVKGLCTSCCSTVLANLCGKLVYLLLVIGAVSILLHYEQR IQIGLLGESFSS
Uniprot No.

Target Background

Function
Glycoprotein that likely modulates membrane fusion events during secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes.
Database Links

KEGG: vg:1487514

Protein Families
Alphaherpesvirinae glycoprotein K family
Subcellular Location
Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Equine Herpesvirus 1 Glycoprotein K and its role in viral replication?

Glycoprotein K (gK) is one of twelve glycoproteins identified in Equine herpesvirus 1 (EHV-1). Although specific information about EHV-1 gK is limited in current research, it belongs to the structural proteins embedded in the viral envelope. Based on studies of related herpesviruses, gK likely plays critical roles in viral entry, cell-to-cell spread, and virion assembly and egress. Unlike more immunogenic glycoproteins such as gB, gC, gD, gG, gI, and gp2, gK appears to be less immunogenic as its expression is not readily recognized by horse sera in immunoblot analysis .

To study gK function, researchers typically employ recombinant DNA technology to create mutant viruses with deletions or modifications to the gK gene. This allows for comparative analysis of growth properties, cell tropism, and virulence compared to wild-type virus. Methodologically, researchers can use CRISPR-Cas9 gene editing or traditional homologous recombination techniques to generate these mutants.

How does recombinant EHV-1 gK differ structurally and functionally from native gK?

Recombinant EHV-1 gK typically refers to gK that has been produced through genetic engineering techniques, either expressed alone in cell culture systems or as part of a modified virus. The structural and functional differences between recombinant and native gK depend largely on the expression system used and any modifications made to the protein.

When expressed in isolation (such as in 293T cells, commonly used for glycoprotein expression), recombinant gK may lack post-translational modifications or protein-protein interactions that occur in the context of viral infection . Research methodology to address this question would include comparative biochemical analysis using techniques such as mass spectrometry to identify differences in glycosylation patterns, as well as functional assays examining membrane fusion activity and protein localization through immunofluorescence microscopy.

What are the established protocols for successful expression of recombinant EHV-1 gK?

Expression of EHV-1 gK presents unique challenges, as studies have shown that unlike other EHV-1 glycoproteins, gK expression is not readily detected by immunoblot analysis using horse sera against EHV-1 . Researchers should consider the following methodological approaches:

  • Cell line selection: While 293T cells are commonly used for glycoprotein expression, they may not be optimal for gK. Consider testing equine-derived cell lines such as equine dermal (ED) cells or fetal horse kidney (FHK) cells.

  • Co-expression strategies: Evidence from other EHV-1 glycoproteins suggests that co-expression with partner proteins can enhance expression and antigenicity. For example, co-expression of gE with gI and gM with gN enhanced their detectability . Researchers should investigate potential binding partners for gK.

  • Expression vector optimization: Incorporate strong promoters (such as CMV) and optimize codon usage for equine cells if expressing in equine cell lines.

  • Detection methods: Develop specific monoclonal antibodies against gK or use epitope tags (HA, FLAG, etc.) fused to gK to facilitate detection.

What are the most effective strategies for creating recombinant EHV-1 with modified gK?

Creating recombinant EHV-1 with modified gK requires careful planning and execution. Based on successful approaches with other glycoproteins, researchers should consider:

  • Two-step Red recombination: This bacterial artificial chromosome (BAC) technology has been successfully used to generate recombinant herpesviruses. The method involves first inserting a selection marker at the gK locus, followed by replacement with the modified gK sequence.

  • CRISPR-Cas9 genome editing: This approach can be used to create precise modifications in the gK gene within the viral genome.

  • Homologous recombination in eukaryotic cells: Following the methods demonstrated with gE/gI deletion mutants, researchers can construct transfer plasmids containing the modified gK flanked by homologous sequences and co-transfect with viral DNA .

  • Complementation system: For lethal mutations, establish a complementing cell line expressing wild-type gK to propagate gK-deficient viruses.

The choice of method should depend on the specific research question, the type of modification desired, and the available resources and expertise.

How can researchers effectively evaluate the immunogenicity of recombinant EHV-1 gK?

Evaluating the immunogenicity of recombinant EHV-1 gK requires multiple approaches due to its apparently low natural immunogenicity. Previous studies have shown that gK expression was not recognized by immunoblot analysis using horse sera, unlike other glycoproteins such as gB, gC, gD, gG, gI, and gp2 .

Methodological approaches should include:

  • Production of high-quality antigen: Express recombinant gK in mammalian expression systems with appropriate post-translational modifications.

  • Development of specific detection tools: Generate monoclonal antibodies against conserved gK epitopes or use epitope-tagged versions.

  • Enhanced detection systems: Consider using amplification systems like biotin-streptavidin for immunoblotting or sensitive ELISA formats.

  • Co-expression strategies: As demonstrated with gE/gI and gM/gN pairs, co-expression with potential partner proteins may enhance antigenicity .

  • In vivo immunogenicity assessment: Inoculate horses with purified recombinant gK with appropriate adjuvants and collect sera at multiple timepoints for antibody analysis.

What cell culture systems are most suitable for studying recombinant EHV-1 gK function?

The selection of appropriate cell culture systems is critical for studying recombinant EHV-1 gK function. Based on research with other EHV-1 glycoproteins:

  • Equine-derived cells: Fetal horse kidney (FHK) cells have been successfully used for glycoprotein expression studies and virus propagation . Equine dermal cells are also commonly used for EHV-1 research.

  • Non-equine cells with varying permissivity: Different cell lines show varying permissivity to EHV-1 and EHV-4, which can be useful for studying specific aspects of glycoprotein function. For example:

    • Vero cells support replication of both EHV-1 and EHV-4

    • RK13 cells support EHV-1 but not EHV-4

    • CrFK cells support EHV-4 but not EHV-1

The following table summarizes cell line permissivity for EHV-1 and EHV-4, which may inform experimental design for recombinant gK studies:

Cell lineEHV-1EHV-4
CHO-K1+-
RK13+-
CrFK-+
MDCK++
Vero++

How does gK interact with other EHV-1 glycoproteins during viral entry and spread?

Understanding the interactions between gK and other EHV-1 glycoproteins requires sophisticated experimental approaches. While specific information on gK interactions is limited, research methodologies should be informed by studies of other glycoprotein interactions:

  • Co-immunoprecipitation assays: These can identify physical interactions between gK and other viral proteins. Evidence from other glycoproteins suggests important functional interactions; for example, gE (95kDa) was co-precipitated with gI (75kDa) by immunoprecipitation using anti-gI serum .

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify proteins in close proximity to gK in living cells.

  • Split reporter assays: Techniques like bimolecular fluorescence complementation can visualize protein-protein interactions in intact cells.

  • Functional complementation studies: As demonstrated with other glycoproteins, co-expression of certain glycoproteins enhances function or antigenicity. For example, co-expression of gE with gI and gM with gN enhanced their detectability . Similar patterns might exist for gK with its potential binding partners.

  • Cryo-electron microscopy: This can provide structural insights into gK's position in the virion and its proximity to other glycoproteins.

What are the evolutionary conservation patterns of gK across different EHV strains and other herpesviruses?

Analyzing the evolutionary conservation of gK provides insights into its functional importance and can guide experimental design. Methodological approaches include:

  • Comparative genomics: Align gK sequences from different EHV-1 strains, other equine herpesviruses (particularly EHV-4), and related alphaherpesviruses to identify conserved domains and variable regions.

  • Structure prediction: Use bioinformatic tools to predict structural features and transmembrane domains of gK across different herpesviruses.

  • Functional domain mapping: Generate chimeric gK proteins containing domains from different herpesvirus species to identify functionally important regions.

  • Selective pressure analysis: Calculate dN/dS ratios to identify sites under positive or purifying selection, which can indicate functional importance.

This evolutionary perspective is particularly relevant given the observed functional differences when exchanging glycoproteins between EHV-1 and EHV-4. For example, replacing gB1 with gB4 in EHV-1 had minimal impact, but EHV-4 with gB1 showed significantly reduced growth . Similar analyses with gK could reveal important species-specific functions.

How does recombinant EHV-1 with modified gK differ in pathogenesis compared to wild-type virus?

Evaluating the role of gK in EHV-1 pathogenesis requires in vivo studies similar to those conducted for other glycoproteins. Research with gE/gI deletion mutants has shown that deletion of these glycoproteins resulted in attenuated virulence in horses . Similar methodological approaches for gK would include:

  • Animal infection models: Inoculate horses intranasally with recombinant EHV-1 containing modified gK and monitor for clinical signs including pyrexia, nasal discharge, and lymph node swelling .

  • Virus shedding studies: Collect nasal swabs at regular intervals to quantify viral shedding using qPCR.

  • Immune response assessment: Collect serum samples to evaluate humoral immunity and perform lymphocyte proliferation assays to assess cell-mediated immunity.

  • Challenge infection: Following primary infection, challenge horses with wild-type virus to assess protective immunity.

  • Post-mortem tissue analysis: In terminal studies, examine tissues for virus distribution and pathological changes.

The experimentally derived data would need careful statistical analysis, particularly when evaluating subtle differences in clinical parameters between groups.

What are common challenges in detecting recombinant EHV-1 gK and how can they be overcome?

Detection of recombinant EHV-1 gK presents significant challenges, as evidenced by studies showing that gK expression was not recognized by immunoblot analysis using horse sera against EHV-1 . Researchers should consider these methodological solutions:

  • Sensitivity enhancement: Use more sensitive detection methods such as chemiluminescence or fluorescence-based immunoblotting instead of chromogenic detection.

  • Epitope tag addition: Engineer recombinant gK with well-characterized epitope tags (HA, FLAG, V5) that have established high-affinity antibodies.

  • Custom antibody development: Generate monoclonal antibodies specifically against conserved epitopes of EHV-1 gK using synthetic peptides or recombinant protein fragments.

  • Sample preparation optimization: Modify protein extraction methods to preserve gK structure, considering its likely transmembrane nature. Use different detergents (NP-40, Triton X-100, CHAPS) to optimize solubilization.

  • Co-expression strategies: Similar to findings with gE/gI and gM/gN pairs, co-express gK with potential binding partners to enhance its stability and detectability .

  • Alternative detection methods: Beyond immunoblotting, consider mass spectrometry-based approaches for protein identification.

How can researchers distinguish between phenotypic effects caused by gK mutation versus unintended genomic changes?

When working with recombinant viruses, distinguishing specific effects of gK mutation from unintended genomic alterations is crucial. Methodological approaches include:

  • Generation of revertant viruses: Create revertant viruses by restoring the wild-type gK sequence in the mutant background. This approach was successfully used in studies of gE/gI deletions, where revertant viruses showed restored virulence .

  • Multiple independent mutants: Generate several independent mutants with the same intended gK modification to confirm consistent phenotypes.

  • Whole genome sequencing: Perform whole genome sequencing of mutant viruses to identify any unintended mutations.

  • Complementation studies: Express wild-type gK in trans (e.g., from a plasmid) in cells infected with the gK-mutant virus to see if this rescues the wild-type phenotype.

  • Targeted sequencing of recombination junctions: Verify the integrity of sequences flanking the modified gK gene to confirm precise modification.

  • Functional assays with defined readouts: Use assays that specifically measure functions likely associated with gK to minimize background effects.

What quality control measures are essential for ensuring the integrity of recombinant EHV-1 gK preparations?

Ensuring the quality and integrity of recombinant EHV-1 gK preparations is critical for experimental reproducibility. Researchers should implement these quality control measures:

  • Sequence verification: Confirm the sequence of the modified gK gene in the final recombinant virus or expression vector through Sanger or next-generation sequencing.

  • Protein integrity assessment: Verify the size and integrity of expressed gK using SDS-PAGE followed by western blotting with tag-specific antibodies or gK-specific antibodies if available.

  • Post-translational modification analysis: Assess glycosylation status using endoglycosidase treatments (PNGase F, Endo H) followed by mobility shift analysis.

  • Functional validation: Develop functional assays specific to gK, such as cell-cell fusion assays if gK is involved in membrane fusion.

  • Lot-to-lot consistency: Establish criteria for batch acceptance based on protein concentration, purity, and functional activity.

  • Stability testing: Evaluate the stability of purified recombinant gK under various storage conditions through activity assays and structural integrity assessments.

What aspects of EHV-1 gK remain understudied compared to other viral glycoproteins?

Despite significant advances in understanding several EHV-1 glycoproteins, gK remains relatively understudied. Key research gaps include:

  • Structural characterization: Unlike better-characterized glycoproteins such as gB, gC, and gD, the detailed structure of gK remains undetermined. Cryo-electron microscopy or X-ray crystallography studies would provide valuable insights.

  • Specific functions: While functions have been attributed to gK in other herpesviruses, the specific roles of EHV-1 gK in viral replication, cell-to-cell spread, and immune evasion are not well defined.

  • Interaction partners: The protein-protein interaction network of gK within the viral envelope and with cellular proteins remains largely unexplored, unlike the well-documented interactions between gE and gI .

  • Immunological significance: While some glycoproteins like gB, gC, gD, gG, gI, and gp2 are known to be immunogenic in horses, the immunological significance of gK is unclear .

  • Role in pathogenesis: The contribution of gK to virulence and tissue tropism, particularly in the context of neurological disease, requires further investigation.

How might CRISPR-Cas9 and other advanced gene editing techniques revolutionize recombinant EHV-1 gK research?

Advanced gene editing technologies offer new opportunities for EHV-1 gK research. Methodological innovations include:

  • Precise genomic modification: CRISPR-Cas9 allows for precise editing of the gK gene within the viral genome, enabling the creation of point mutations, small deletions, or insertions without disrupting surrounding sequences.

  • Multiplex editing: Simultaneous modification of gK and other viral genes can help uncover functional redundancies or synergies between viral proteins.

  • Conditional knockouts: Integration of inducible systems allows for temporal control of gK expression, enabling studies of its role at specific stages of the viral life cycle.

  • High-throughput mutagenesis: Creation of libraries of gK variants can facilitate comprehensive structure-function analyses.

  • In vivo editing: Potentially, direct editing of viral genomes in infected animals could provide insights into gK function in the natural host context.

  • Fluorescent tagging: Precise insertion of fluorescent protein tags can enable real-time visualization of gK localization and trafficking during infection.

These approaches significantly expand the toolkit available to researchers beyond traditional homologous recombination techniques used in earlier studies of glycoproteins like gE and gI .

What potential applications exist for recombinant EHV-1 gK in vaccine development and diagnostic assays?

Recombinant EHV-1 gK holds promise for both vaccine development and diagnostics, though these applications remain largely unexplored. Potential research directions include:

  • Marker vaccines: Similar to the gE/gI deletion mutants that showed attenuation in horses , gK-modified viruses could potentially serve as live attenuated marker vaccines, allowing differentiation between infected and vaccinated animals.

  • Subunit vaccines: Recombinant gK, possibly in combination with other immunogenic glycoproteins, could form the basis of subunit vaccines. The challenge of gK's apparently low immunogenicity would need to be addressed, perhaps through adjuvant optimization.

  • Diagnostic antigen: While horse sera did not readily recognize gK in initial studies , optimized recombinant gK preparations could potentially serve as antigens in serological assays.

  • Differential diagnosis: If antibody responses to gK differ between EHV-1 and related viruses, this could be exploited for differential diagnosis, similar to the approach used with gE epitopes to differentiate EHV-1 and EHV-4 infections .

  • Functional assays: Recombinant gK could be used in in vitro assays to study virus-host interactions and screen for antiviral compounds targeting these interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.