Recombinant Equine herpesvirus 1 Virion egress protein 26 (26)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NEC2; 26; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)
Target Names
NEC2
Target Protein Sequence
MDSYNYRDFAVGGGLLQRIRLVVSGSLHCGESDATLNDPKHLPARCVFQFSGPDNNSVTF PIEYVLRLMKNWARSQCDPYIRIQNTGVSVLFQGFFFAPPNAPMASITSEHNNVILKSTH TTGLALSGIERVKRGGGLDLRPLQAMMQISCFTRMPVVQLSFRFMGPEDASRTQRLLERA TSFGAMELHQKRTVDSCDRSNGIVSPREHRECRERQKRRPTPKRCASEVFASLASISSAF ASERVKRRPVRIAAAILAFVFVAVILAIATKGRLF
Uniprot No.

Target Background

Function

This protein plays a crucial role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, it interacts with the newly formed capsid via its vertices, directing it to the inner nuclear membrane through association with NEC2. It then initiates capsid budding at the inner nuclear membrane and subsequent envelopment within the perinuclear space. The protein complex further facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm for transport to secondary budding sites in the Golgi apparatus or trans-Golgi network.

Database Links

KEGG: vg:1487492

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is Equine Herpesvirus 1 Virion Egress Protein 26?

Virion egress protein 26 is a type II membrane protein encoded by ORF26 of Equine herpesvirus 1. It functions as a nuclear egress membrane protein that facilitates the exit of viral particles from the nucleus during replication. This protein plays a crucial role in primary envelopment, allowing nucleocapsids to traverse the nuclear membrane . It interacts with nuclear egress lamina protein and is essential for proper virion assembly and egress.

The protein is structurally characterized as a transmembrane protein with specific domains that enable its localization to nuclear membranes during infection. Like other herpesvirus egress proteins, it serves as part of the molecular machinery that guides viral capsids from the nucleus to the cytoplasm during the complex multi-step virion maturation process.

What Role Does Virion Egress Protein 26 Play in EHV-1 Replication?

Virion egress protein 26 is critical for nuclear egress, an essential step in the EHV-1 replication cycle. Similar to other related viral proteins like ETIF (VP16-E), it facilitates the movement of assembled nucleocapsids from the nucleus to the cytoplasm . The protein likely functions as follows:

  • Participates in primary envelopment at the inner nuclear membrane

  • Forms part of the nuclear egress complex (NEC)

  • Facilitates budding of nucleocapsids through the nuclear envelope

  • Contributes to de-envelopment at the outer nuclear membrane

Defects in this protein would likely result in nucleocapsids accumulating in the nucleus, significantly impairing viral replication. Studies with similar EHV-1 proteins have shown that deficiencies in viral egress proteins result in reduced viral titers and impaired growth kinetics .

How Does EHV-1 Virion Egress Protein 26 Contribute to Viral Pathogenesis?

While not directly addressed in the search results for this specific protein, we can infer its importance to pathogenesis by analyzing related viral components. As a nuclear egress protein essential for productive viral replication, any reduction in its function would likely decrease viral load and consequently reduce disease severity.

Studies of EHV-1 mutants with deletions in other genes have demonstrated reduced pathogenicity in animal models . For example, an ORF1/71 gene deletion mutant showed less virulence than wild-type virus in experimental infections, with infected horses showing reduced fever and nasal shedding . By analogy, defects in Virion egress protein 26 would likely result in attenuated virulence due to inefficient replication and spread.

What Are the Common Methods for Producing Recombinant EHV-1 Virion Egress Protein 26?

Recombinant EHV-1 Virion egress protein 26 can be produced using several expression systems, including:

  • E. coli expression systems

  • Yeast expression systems

  • Baculovirus expression systems

  • Mammalian cell expression systems

The choice of expression system depends on research needs, particularly regarding post-translational modifications and protein folding. Commercial preparations typically have >90% purity and are supplied in liquid form containing glycerol for stability . For optimal storage, the protein should be kept at -20°C or -80°C for extended periods.

What Experimental Approaches Are Most Effective for Studying EHV-1 Virion Egress Protein 26 Function?

Based on successful approaches used with other EHV-1 proteins, the following experimental methods are recommended:

Genetic Manipulation Approaches:

  • Generation of gene deletion mutants using BAC technology, similar to approaches used for other EHV-1 genes

  • Site-directed mutagenesis of key residues to evaluate their functional importance

  • Creation of fusion proteins with fluorescent markers for localization studies

Functional Assays:

  • Multi-step growth kinetics comparing wild-type and mutant viruses

  • Plaque size and morphology analysis to assess cell-to-cell spread

  • Ultrastructural studies using electron microscopy to visualize virion assembly and egress defects

Protein Analysis Methods:

  • Western blot analysis of infected cell lysates and purified virions to detect expression and incorporation

  • Subcellular fractionation to determine precise localization

  • Co-immunoprecipitation to identify viral and cellular interaction partners

These approaches have successfully revealed functions of other EHV-1 proteins, such as US2 and ETIF, and would likely be effective for studying Virion egress protein 26 .

How Do Mutations in the Virion Egress Protein 26 Gene Affect Viral Replication?

Studies on other essential EHV-1 proteins provide insights into likely effects of Virion egress protein 26 mutations. For example, research on the ETIF protein demonstrated that an ETIF-null mutant could not be reconstituted after transfection unless complemented in a supporting cell line . Ultrastructural studies revealed:

  • Marked defects in secondary envelopment at cytoplasmic membranes

  • Very few enveloped virions in transport vesicles

  • Limited presence of virions in the extracellular space

Similarly, mutations in EHV-1 glycoprotein D (gD) that affected key functional residues resulted in replication-deficient viruses with impaired growth kinetics . By analogy, mutations in Virion egress protein 26 would likely:

  • Disrupt nuclear egress of nucleocapsids

  • Lead to accumulation of capsids in the nucleus

  • Result in significant reduction in viral titers

  • Potentially create a replication-deficient phenotype

These effects would be particularly severe if mutations occurred within the transmembrane domain or other regions critical for protein-protein interactions.

What Is the Molecular Mechanism of Virion Egress Protein 26-Mediated Nuclear Egress?

Based on knowledge of herpesvirus nuclear egress generally, Virion egress protein 26 likely functions through the following mechanism:

  • Complex formation: Virion egress protein 26 associates with nuclear egress lamina proteins to form a nuclear egress complex (NEC)

  • Nuclear membrane remodeling: The NEC disrupts the nuclear lamina locally to allow access to the inner nuclear membrane

  • Primary envelopment: The complex facilitates budding of nucleocapsids through the inner nuclear membrane, acquiring a primary envelope

  • De-envelopment: Fusion of the primary envelope with the outer nuclear membrane releases naked capsids into the cytoplasm

  • Secondary envelopment: Capsids subsequently acquire their final envelope at cytoplasmic membranes

This process is essential for productive viral infection, as demonstrated by studies of the ETIF protein, which showed that defects in viral egress components severely impair virion production .

How Does Virion Egress Protein 26 Interact with the Host Immune System?

  • MHC-I downregulation: EHV-1 proteins like pUL56 (encoded by ORF1) downregulate MHC-I expression on infected cells, helping the virus evade cytotoxic T-lymphocyte recognition

  • Modulation of chemokine responses: Viral proteins like gG and gp2 control recruitment of leukocytes to infection sites

  • Interference with antigen presentation: The protein pUL49.5 inhibits the transporter associated with antigen processing (TAP)

What Research Models Are Most Appropriate for Studying Virion Egress Protein 26 Function?

Based on EHV-1 research approaches documented in the search results, the following models are recommended:

In Vitro Models:

  • Equine dermal (ED) cells - Standard cell line for EHV-1 propagation and functional studies

  • NBL6 cells - Equine dermal fibroblasts used for growth kinetics and virus characterization

  • RK13 cells - Rabbit kidney cells commonly used for EHV-1 transfection experiments

In Vivo Models:

  • CBA mice - Established model for evaluating EHV-1 pathogenicity, with notable differences in outcomes between virulent strains like RacL11 (causing severe disease) and attenuated strains like KyA

  • Equine model - Natural host providing most relevant pathological outcomes, though with practical limitations

Ex Vivo Models:

  • Upper respiratory tract tissue samples - Useful for studying viral replication at the mucosal entry site, allowing comparison between immune and non-immune states

Data comparison from experimental infections in mice and horses has revealed consistent patterns of attenuation for certain gene deletion mutants, suggesting the reliability of these models for studying virion proteins .

How Do Different EHV-1 Strains Vary in Their Virion Egress Protein 26?

Strain Variations Observed in Other EHV-1 Proteins:

StrainUS2 Protein SizeMutation TypeVirulenceReference
RacL1134,000-MrWild-typeHigh
Ab444,000-MrFrameshiftHigh
RacH31,000-MrDeletionAttenuated

Additionally, EHV-1 strain KyA has been shown to have deletions in multiple genes (UL17, US6, US7, and US8) compared to strains RacL11 and Ab4, contributing to its attenuated phenotype . Similar strain-specific variations might exist in Virion egress protein 26, potentially contributing to differences in viral growth characteristics and pathogenicity.

What Potential Does Virion Egress Protein 26 Hold as a Target for Antiviral Development?

Virion egress protein 26 represents a promising target for antiviral development for several reasons:

  • Essential function: As a nuclear egress protein, it's likely essential for viral replication, making it an attractive target

  • Specific to viral process: The nuclear egress mechanism is relatively unique to herpesviruses, potentially allowing for specific targeting

  • Conservation: Nuclear egress proteins tend to be fairly conserved among alphaherpesviruses, suggesting potential for broad-spectrum activity

Possible antiviral strategies might include:

  • Small molecule inhibitors that disrupt interactions between Virion egress protein 26 and other components of the nuclear egress complex

  • Peptide inhibitors that mimic binding interfaces

  • CRISPR-based approaches targeting the gene encoding the protein

Recent research with EHV-1 glycoprotein D demonstrated that specific mutations (F213A and D261N) created replication-deficient viruses, illustrating how targeting essential viral proteins can dramatically impair viral growth . Similar approaches targeting Virion egress protein 26 might yield effective antivirals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.