Recombinant Equine herpesvirus 2 Glycoprotein H (22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gH; 22; Envelope glycoprotein H; gH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-763
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 2 (strain 86/87) (EHV-2)
Target Names
gH
Target Protein Sequence
IGGRGLATPYPSTPEFSGSPGSRATSGSPGTPKSLSATPRKILPTAKSVNYTEMIEKNPS LTIDLGNQTKYQLNWTDVVKVIPGELIEKMWEESNVTESLWFTLNKFTDVYKKDTIFKNF TGHFTTKYVCNVSQGEPNYNVSQREVKEIKEYDGKFGIPAPVVLSDLLASVNYVLRPQHA THNVFYTTRDYDAYFSVFFGDKDTQMLGYITRDFSFVTAVSWTNGTFRFLTTMMGYTDRL PVLKGHLIYKTDFIVGQNERFSMVILTTFLDHAYFESLVHPDFQGIFKDLTERPPAEVIV ELQDKMVELEATQKCPVQSMSKITFEYVLKFAFSHFMAVAGLEDAGQHVKVRCLFDVLHE LALLRAMTATCFHPFYFKGFTSNHLSSVATVMVTRTPIKQLKTFSHGDRDAVLATLQVAD NVKEATDRILWAAAEIMDDIYTAYTDSFYLKLEDRGHLLDVFVLLRDKEKQHQVLKNRNL MIIYLTAGSMCNSVEISTVTSMLSDKNHYSLRRTFSPCLMSLRFDFTKDKLISETRLLPN MTYLRAEDGATGFFNILRDRHVATFNLLPVSSCLKAYAKNILMVIPMFNLTYVVSTAPIS IGINYDVRDTFIEKKMFVSAVMSNCSTFPEGSGTRQIPIVYNITRSRSECPLCGAAFLAY DERDGLESMMYVTNRRVERNIFSDASPFFDNQNLHTHYLMLFKNGTVIEIRGRYRERTAQ FIIITLFILTLMFGAFLAFKIFVYCC
Uniprot No.

Target Background

Function

The heterodimeric glycoprotein H-glycoprotein L is crucial for the fusion of viral and host cell plasma membranes, enabling viral entry. Following initial receptor binding, membrane fusion is facilitated by the fusion machinery comprising gB and the gH/gL heterodimer. This complex may also participate in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.

Database Links

KEGG: vg:1461019

Protein Families
Herpesviridae glycoprotein H family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein.

Q&A

What is Equine Herpesvirus 2 Glycoprotein H and what is its role in viral pathogenesis?

Glycoprotein H (gH) is a conserved viral envelope protein present in all herpesviruses, including Equine herpesvirus 2. The glycoprotein plays an essential role in viral replication, particularly in cell-to-cell spread, and significantly affects plaque size and growth kinetics. Based on studies of related alphaherpesviruses, gH forms a heterodimer with glycoprotein L (gL) and functions as a fusion regulator rather than possessing direct fusogenic properties itself . Although most detailed studies have been performed on EHV-1 and EHV-4, the fundamental roles are likely conserved in EHV-2, where gH is similarly important for viral entry into host cells.

Current research indicates that gH/gL complexes do not resemble typical fusion proteins structurally, but instead regulate the fusion process initiated by other viral glycoproteins . This regulatory function makes gH a critical component in understanding how gammaherpesviruses like EHV-2 establish infection.

How does the structure of recombinant EHV-2 Glycoprotein H(22) differ from native viral protein?

The recombinant form of EHV-2 Glycoprotein H(22) typically encompasses amino acids 18-763 of the full protein sequence, which maintains the functional domains while excluding the signal peptide and potentially problematic hydrophobic transmembrane regions . The recombinant protein preserves key structural elements including:

  • N-terminal domain that typically interacts with gL

  • Central domain containing functional motifs

  • The bulk of the C-terminal region

The recombinant protein may include a tag (determined during the production process) to facilitate purification and detection in experimental settings . Importantly, while the recombinant form retains most antigenic properties, it may lack post-translational modifications present in the native viral context, particularly certain glycosylation patterns that require specific cellular machinery. This is an important consideration when using the recombinant protein for immunological studies or as a potential vaccine component.

What are the optimal storage and handling conditions for maintaining EHV-2 glycoprotein H activity?

For optimal preservation of recombinant EHV-2 glycoprotein H functional activity, the protein should be stored in Tris-based buffer containing 50% glycerol at -20°C for regular storage or at -80°C for extended storage periods . Researchers should note several critical handling parameters:

  • Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided

  • Working aliquots can be maintained at 4°C for up to one week

  • Dilution should be performed in buffer optimized for the specific protein

  • The presence of glycerol in the storage buffer helps prevent freezing damage

When planning experiments, it's advisable to prepare single-use aliquots upon receipt of the protein to minimize freeze-thaw degradation. Researchers should also consider validating protein activity after extended storage using functional assays specific to glycoprotein H, such as cell binding or fusion assays.

What PCR-based methods are most effective for detecting EHV-2 glycoprotein H gene in clinical samples?

Multiplex real-time PCR (rtPCR) represents the most sensitive approach for detecting the EHV-2 glycoprotein H gene in clinical specimens. Current protocols target the glycoprotein H gene of EHV-2 in combination with the E11 gene of EHV-5, allowing simultaneous detection of both gammaherpesviruses . This approach offers several advantages:

  • High analytical specificity for differentiating between EHV-2 and other equine herpesviruses

  • Increased throughput through multiplexing

  • Quantitative assessment of viral load when standard curves are employed

  • Reduced cross-contamination risk compared to nested PCR approaches

For researchers working with field samples, nasal swabs represent the preferred specimen type for EHV-2 detection, with studies from Southern Brazil demonstrating detection rates of approximately 15.3% in asymptomatic adult horses . When designing primers for glycoprotein H detection, targeting conserved regions while avoiding areas of high sequence variation between strains is critical for reliable results.

How can researchers distinguish between antibodies targeting different epitopes of EHV-2 glycoprotein H in serological assays?

Distinguishing between antibodies targeting different epitopes of EHV-2 glycoprotein H requires sophisticated epitope mapping approaches. While the search results don't provide specific information on EHV-2 gH epitope mapping, extrapolation from related herpesvirus research suggests several effective strategies:

  • Competitive ELISA assays: Using monoclonal antibodies with known epitope specificity to compete with test sera can help determine which epitopes are recognized.

  • Peptide arrays: Synthesized overlapping peptides covering the full gH sequence can identify linear epitopes recognized by antibodies.

  • Domain-specific recombinant fragments: Creating truncated versions of gH containing specific domains allows mapping of domain-specific responses.

  • Site-directed mutagenesis: Introducing point mutations at putative epitope sites in the recombinant protein can confirm specific amino acid contributions to antibody binding.

Researchers should note that the heavily glycosylated nature of herpesvirus glycoproteins means that some conformational epitopes may be poorly represented in recombinant bacterial systems that lack appropriate post-translational modifications. Expression systems like mammalian cells or insect cells may better preserve conformational epitopes for comprehensive mapping studies.

How can recombinant EHV-2 glycoprotein H be utilized in receptor binding studies?

Recombinant EHV-2 glycoprotein H serves as a valuable tool for investigating viral receptor interactions, though experimental design must account for several factors:

  • Protein immobilization approaches:

    • Direct coating on ELISA plates

    • Biotinylation and capture on streptavidin surfaces

    • Fusion with Fc fragments for oriented capture using protein A/G

  • Cell binding assays:

    • Flow cytometry with fluorescently labeled recombinant gH

    • Surface plasmon resonance for real-time binding kinetics

    • Proximity ligation assays to detect gH-receptor interactions in situ

Based on studies with related herpesviruses, researchers should consider investigating whether EHV-2 gH interacts with integrins, although it's worth noting that for EHV-1 and EHV-4, α4β1 and α4β7 integrins were found not to be essential for viral entry . This suggests that receptor binding studies should explore alternative cellular receptors.

When designing receptor identification experiments, it's critical to determine whether gH alone is sufficient for binding or if the gH/gL heterodimer is required, as is the case with many herpesviruses where gL is necessary for proper folding, trafficking, and function of gH .

What are the methodological considerations for using recombinant EHV-2 glycoprotein H in vaccine development?

Utilizing recombinant EHV-2 glycoprotein H in vaccine development requires careful consideration of several methodological factors:

  • Immunogen formulation:

    • Adjuvant selection significantly impacts immune response quality

    • Glycoprotein conformation must be preserved during formulation

    • Combination with other viral antigens may provide broader protection

  • Delivery platforms:

    • Subunit vaccines containing purified recombinant gH

    • DNA vaccines encoding gH for in vivo expression

    • Viral vector vaccines (e.g., adenovirus, modified vaccinia Ankara)

    • Virus-like particles incorporating gH

  • Immune response assessment:

    • Neutralizing antibody titers against EHV-2

    • Cell-mediated immune responses to gH epitopes

    • Challenge studies to evaluate protection

The decision to use full-length versus truncated gH should be informed by functional studies. Research on EHV-1 glycoprotein gp2 has demonstrated that truncated and full-length versions are not functionally equivalent , suggesting that similar considerations may apply to gH. While truncated versions may be easier to produce, they might not elicit antibodies against all relevant epitopes present in the native protein.

Based on the early infection of foals with EHV-2 despite maternal antibodies , vaccine strategies should consider the unique challenges of inducing protection in young animals with immature immune systems and potential maternal antibody interference.

How does the function of EHV-2 glycoprotein H compare with homologous proteins in other herpesviruses during membrane fusion?

Comparative analysis of EHV-2 glycoprotein H with homologous proteins from other herpesviruses reveals important functional similarities and distinctions. Based on studies of related herpesviruses:

  • Conserved functional mechanism:

    • Like other herpesviruses, EHV-2 gH likely acts as a fusion regulator rather than having direct fusogenic properties

    • Forms a heterodimer with gL that is critical for proper function

    • Participates in a coordinated fusion process with other viral glycoproteins

  • Structural organization:

    • Crystal structures of HSV-2, EBV, and PRV gH reveal three distinct domains

    • N-terminal domain (domain H1) binds to gL

    • Unlike many fusion proteins, herpesvirus gH/gL complexes lack typical fusion protein structures

  • Fusion process participation:

    • In alphaherpesviruses, fusion is a stepwise process beginning with gD binding to receptors

    • This is followed by activation of gH/gL to prime gB for fusion

    • The exact sequence and molecular interactions likely differ somewhat in gammaherpesviruses like EHV-2

Current understanding suggests that herpesvirus entry involves a highly coordinated sequence where gH/gL complexes serve as intermediaries that translate receptor binding events into activation of the actual fusion machinery. Researchers investigating EHV-2 gH should design experiments that examine these protein-protein interactions, particularly how gH interacts with other viral glycoproteins during the entry process.

What role does glycoprotein H play in EHV-2 cell-to-cell spread compared to cell-free virus transmission?

Glycoprotein H plays distinct roles in cell-to-cell spread versus cell-free virus transmission for herpesviruses. For EHV-2 specifically:

  • Cell-to-cell spread mechanisms:

    • Direct transfer of virus between adjacent cells through cell junctions

    • Reduced exposure to neutralizing antibodies

    • Likely requires coordinated action of multiple viral glycoproteins

  • Cell-free virus transmission:

    • Release of complete virions into extracellular space

    • Greater dissemination potential but increased vulnerability to immune responses

    • Dependent on successful attachment and entry into new target cells

Studies with EHV-1 have shown that gH is essential for virus replication and plays a significant role in cell-to-cell spread, affecting plaque size and growth kinetics . Similar functions are likely conserved in EHV-2 gH, though potentially with modifications reflective of its gammaherpesvirus biology.

The interaction between different viral glycoproteins is particularly important in the context of cell-to-cell spread. In EHV-1, the gE-gI complex facilitates cell-to-cell spread, with gE-gI-negative viruses inducing only small plaques compared to their parental viruses . Research into EHV-2 gH should investigate whether similar glycoprotein interactions occur and how they influence the efficiency of viral spread between cells.

What are the technical challenges in expressing full-length functional EHV-2 glycoprotein H in heterologous systems?

Expressing full-length functional EHV-2 glycoprotein H in heterologous systems presents several technical challenges that researchers must address:

  • Transmembrane domain complications:

    • Hydrophobic transmembrane regions can cause protein aggregation

    • May require detergent solubilization or truncation strategies

    • Specialized expression vectors with optimized secretion signals

  • Post-translational modification requirements:

    • Proper glycosylation patterns are critical for function and immunogenicity

    • Bacterial systems lack glycosylation machinery

    • Mammalian, insect, or yeast expression systems may better preserve native structure

  • Heterodimer formation with gL:

    • gL is often required for proper folding and trafficking of gH

    • Co-expression systems may be necessary for functional protein

    • Stabilization of the heterodimer through protein engineering

  • Protein size and stability issues:

    • Large glycoproteins present expression and purification challenges

    • Proteolytic degradation during expression

    • Reduced yield compared to smaller proteins

The expression system selection should be guided by the intended application. For structural studies, insect cell systems often provide a good balance between yield and post-translational modifications. For functional studies, mammalian expression systems that more closely mimic equine cellular machinery may be preferred despite potentially lower yields.

How can researchers leverage knowledge of EHV-1 and EHV-4 glycoprotein H function to understand EHV-2 pathogenesis?

Researchers can employ several strategic approaches to leverage knowledge from EHV-1 and EHV-4 research to understand EHV-2 pathogenesis:

  • Comparative genomic analysis:

    • Sequence alignment to identify conserved functional domains

    • Prediction of structural similarities and differences

    • Identification of unique motifs that may explain biological differences

  • Functional domain swap experiments:

    • Creation of chimeric glycoproteins containing domains from different EHV types

    • Assessment of changes in cell tropism, fusion efficiency, and immunogenicity

    • Identification of domains responsible for specific functions

  • Receptor utilization studies:

    • Investigation of whether EHV-2 gH interacts with the same cellular components

    • While α4β1 and α4β7 integrins are not essential for EHV-1 and EHV-4 entry , determining if this holds true for EHV-2

    • Exploration of alternative entry mechanisms in different cell types

Studies on EHV-1 have demonstrated that glycoproteins play crucial roles in cellular entry, with different mechanisms operating in different cell types. For instance, entry of EHV-1 can occur via endocytosis or fusion at the plasma membrane depending on the cell type infected . Exploring whether EHV-2 exhibits similar cell type-dependent entry mechanisms would provide valuable insights into its pathogenesis.

What immunological differences exist between immune responses to EHV-2 glycoprotein H compared to other equine herpesvirus glycoproteins?

Understanding the immunological differences between responses to EHV-2 glycoprotein H and other equine herpesvirus glycoproteins provides critical insights for diagnostic and vaccine development:

  • Antibody response characteristics:

    • Kinetics of antibody development

    • Isotype distribution (IgG subclasses, IgA, IgM)

    • Neutralizing versus non-neutralizing epitope recognition

    • Cross-reactivity with other herpesvirus glycoproteins

  • Cell-mediated immune responses:

    • T-cell epitope mapping

    • CD4+ versus CD8+ T-cell responses

    • Cytokine profiles induced

  • Maternal immunity effects:

    • Transfer of maternal antibodies targeting gH

    • Duration of protection provided by maternal antibodies

    • Interference with active immunization

Research has shown that foals become infected with EHV-2 early in life, despite the presence of maternal antibodies , suggesting that natural immunity to EHV-2 may be incomplete or that the virus has evolved mechanisms to evade antibody-mediated neutralization. This highlights the importance of understanding which epitopes on gH induce neutralizing versus non-neutralizing antibodies, and whether immunodominant epitopes correspond to functionally important regions of the protein.

Comparative immunological studies should also investigate whether gH from EHV-2 (a gammaherpesvirus) elicits fundamentally different immune response patterns compared to gH from the alphaherpesviruses EHV-1 and EHV-4, which could inform both vaccine design and diagnostic test interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.