Recombinant Equine herpesvirus 2 SUSHI domain-containing protein E3 (E3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
E3; SUSHI domain-containing protein E3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-174
Protein Length
full length protein
Species
Equine herpesvirus 2 (strain 86/87) (EHV-2)
Target Names
E3
Target Protein Sequence
GTPTPSKSTLIYNSQNCTTYPSIENGQSSLYYNGSWFIRYEFNCSSGYELQGWPYTTCIF WPKNGTIWTNGPPSCVKLNITTTLMPTSTSTTPVTTGTFPDPQNTTHPTHHTVKPTRRPI NLLRFGYTPWAIITLVVIILLVVWIVNCCMGPMF
Uniprot No.

Target Background

Database Links

KEGG: vg:1461071

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

Intermediate Research Questions

  • How do recombination patterns in EHV-2 compare to other equine herpesviruses?

    Comparative analysis of recombination patterns reveals significant differences between EHV-2 and other equine herpesviruses:

    CharacteristicEHV-2EHV-1EHV-4
    Recombination frequencyCommonRareCommon
    Detection method sensitivityMultiple methods detect recombinationLimited detection even with sensitive methodsConsistently detected across methods
    Genomic regions affectedMultiple regionsPrimarily IR region (when present)UL, US, and IR regions
    Evidence strengthStrong evidence for widespread recombinationLimited evidence for recombinationStrong evidence for widespread recombination

    The Phi test, which is designed to detect recombination in a set of aligned sequences, consistently identifies recombination in the UL region of EHV-4 but not in EHV-1. Additional analytical methods using RDP4 software have detected evidence of recombination events in multiple regions of EHV-4 (UL, US, and IR) but identified only one potential recombination event in the IR region of EHV-1 .

    The difference in recombination patterns may be related to the different epidemiological characteristics of these viruses, suggesting fundamentally different biological behaviors that could influence vaccination strategies and evolution of these viruses .

  • What are the structural characteristics of EHV-2 virions and how do they relate to protein function?

    Electron microscopy studies of EHV-2 have revealed several important structural features:

    a) Virion Morphology:

    • Diameter measurements consistent with herpesvirus family

    • Presence of glycoprotein spikes on the viral envelope

    • Undefined tegument protein characteristic of herpesviruses

    • Empty capsid structures (A-capsids) observed as precursors of mature virions

    b) Glycoprotein Profile:

    • Six distinct glycoproteins identified for EHV-2

    • Similar but distinguishable profile compared to EHV-5

    • Glycoprotein B (gB) identified as particularly immunodominant

    c) Structural Protein Analysis:

    • SDS-PAGE analysis shows virus-specific bands

    • Both common and type-specific epitopes present between EHV-2 and EHV-5

    • 64K protein identified as EHV-2 gB

    • 66K protein identified as EHV-5 gB

    These structural characteristics are essential for understanding the viral life cycle, including attachment, entry, assembly, and immune evasion strategies of EHV-2.

  • What methodologies can be used to express and purify recombinant EHV-2 proteins for research?

    Several approaches have been documented for expression and purification of recombinant EHV-2 proteins:

    a) Prokaryotic Expression Systems:

    • E. coli-based expression of defined protein regions (e.g., 0.71 kb region of gB gene)

    • Fusion protein strategies to enhance solubility and purification

    • IPTG-inducible promoter systems

    b) Viral Vector-Based Expression:

    • Use of en passant mutagenesis for generating recombinant herpesviruses

    • Two-step Red recombination method utilizing I-SceI restriction sites

    • GS1783 E. coli strain containing Red genes and I-SceI gene for optimal efficiency

    c) Purification Strategies:

    • Affinity chromatography using tag systems

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

    • Verification through Western blot analysis and ELISA

    d) Quality Control Measures:

    • SDS-PAGE to confirm protein size and purity

    • Western blot to verify identity

    • Functional assays to confirm biological activity

    • Storage optimization (typically in Tris-based buffer with 50% glycerol at -20°C)

  • How can EHV-2 genetic diversity be analyzed and what are the implications for recombinant protein studies?

    EHV-2 demonstrates substantial genetic diversity, which can be analyzed through several complementary approaches:

    a) Phylogenetic Analysis:

    • Sequence alignment using Clustal W

    • Neighbor-joining tree construction

    • Bootstrap analysis (1,000 replicates) to provide support for individual nodes

    b) Next-Generation Sequencing:

    • Deep sequencing of viral genomes

    • Assembly using Trinity or similar software

    • Mapping reads to reference genomes (e.g., EHV-2 strain G9/92)

    • Identification of strain-specific variations

    c) PCR-Based Methods:

    • Design of strain-specific primers targeting conserved and variable regions

    • Nested PCR approaches for improved sensitivity

    • Restriction enzyme analysis for strain differentiation

    The implications of this genetic diversity for recombinant protein studies include:

    • Need for careful selection of reference sequences for cloning

    • Potential functional differences between protein variants

    • Importance of validating recombinant protein activity against natural isolates

    • Consideration of strain-specific variations in epitope mapping studies

Advanced Research Questions

  • What experimental approaches are optimal for studying the function of EHV-2 SUSHI domain-containing protein E3?

    Several complementary experimental approaches can be employed to elucidate the function of the EHV-2 SUSHI domain-containing protein E3:

    a) Structural Studies:

    • X-ray crystallography of purified protein

    • NMR spectroscopy for solution structure determination

    • Cryo-electron microscopy for visualization in complex with potential binding partners

    • Molecular modeling and docking simulations

    b) Protein-Protein Interaction Analysis:

    • Yeast two-hybrid screening against host proteins

    • Co-immunoprecipitation followed by mass spectrometry

    • Surface plasmon resonance to determine binding kinetics

    • FRET/BRET assays for real-time interaction monitoring in live cells

    c) Functional Assays:

    • Complement activation/inhibition assays (relevant due to SUSHI domains often being involved in complement regulation)

    • Cell adhesion assays to identify roles in viral attachment

    • Immune evasion functional studies

    • Virus neutralization assays with anti-E3 antibodies

    d) Cell Biology Approaches:

    • Fluorescently tagged E3 protein localization studies

    • Time-lapse microscopy during infection

    • siRNA knockdown of interacting host proteins

    • CRISPR-mediated genome editing for host factor studies

    e) Animal Models:

    • Experimental infection studies in horses with wild-type vs. E3-mutant viruses

    • Assessment of viral load and tissue distribution

    • Immune response characterization

    • Correlation with disease manifestations such as pulmonary fibrosis

  • How can structural data inform understanding of EHV-2 SUSHI domain-containing protein E3 function in immune evasion?

    The SUSHI domain (also known as complement control protein domain) is typically associated with complement regulation in host proteins. For viral proteins containing this domain, structural information can provide significant insights:

    a) Structure-Function Correlation:

    • Determination of the three-dimensional structure of EHV-2 E3 can reveal surface-exposed residues likely involved in molecular interactions

    • Comparison with host SUSHI domain-containing proteins that regulate complement (e.g., Factor H, CR1, C4BP) can identify structural mimicry

    • Identification of conserved vs. variable regions across viral strains can highlight functionally essential residues

    b) Binding Interface Mapping:

    • Mutagenesis of specific residues based on structural data can identify key amino acids involved in function

    • Co-crystal structures with putative binding partners can precisely define interaction surfaces

    • Molecular dynamics simulations can reveal conformational changes upon binding

    c) Comparative Analysis with Other Viral Immune Evasion Proteins:

    • Structural comparison with herpesvirus immune evasion proteins from human cytomegalovirus, Kaposi's sarcoma-associated herpesvirus, or Epstein-Barr virus

    • Identification of conserved structural features despite low sequence homology

    • Prediction of functional mechanisms based on structural similarities

    d) Rational Design Applications:

    • Structure-based design of inhibitors that could block E3 function

    • Development of non-neutralizing antibodies that specifically recognize E3 for diagnostic purposes

    • Engineering modified E3 proteins with enhanced or altered functions for research tools

  • What challenges exist in expressing and purifying recombinant EHV-2 proteins and how can they be addressed?

    Expression and purification of recombinant viral proteins, including EHV-2 SUSHI domain-containing protein E3, present several challenges that can be addressed with specific methodological approaches:

    ChallengePotential SolutionsTechnical Considerations
    Protein misfolding- Use of solubility tags (MBP, SUMO, Thioredoxin)
    - Low-temperature induction
    - Co-expression with chaperones
    - Periplasmic expression
    - Tag removal may affect protein stability
    - Optimization required for each construct
    - Expression yield may decrease at lower temperatures
    Disulfide bond formation- Expression in specialized E. coli strains (Origami, SHuffle)
    - Oxidative refolding from inclusion bodies
    - Expression in eukaryotic systems
    - SUSHI domains contain conserved disulfide bonds essential for proper folding
    - Refolding protocols need careful optimization
    Low expression yield- Codon optimization
    - Use of strong inducible promoters
    - High cell density fermentation
    - Baculovirus expression systems
    - Codon usage tables specific for expression system should be used
    - Expression conditions require systematic optimization
    Protein toxicity- Tight regulation of expression
    - Use of less leaky promoters
    - Cell-free expression systems
    - Basal expression levels must be minimized
    - Screening multiple constructs with varying boundaries
    Purification challenges- Tandem affinity purification
    - Ion exchange chromatography
    - Size exclusion as final polishing step
    - On-column refolding
    - Buffer optimization critical for protein stability
    - Removal of contaminating nucleic acids may be necessary
    Protein stability- Addition of stabilizing agents (glycerol, specific ions)
    - Storage at -80°C with cryoprotectants
    - Lyophilization for long-term storage
    - Stability testing under various conditions recommended
    - Functional assays to verify activity retention

    When expressing the SUSHI domain-containing protein E3 specifically, particular attention should be paid to the correct formation of disulfide bonds that are characteristic of this domain and critical for its proper folding and function.

  • How can EHV-2 E3 protein be utilized in diagnostic development and disease monitoring?

    The EHV-2 SUSHI domain-containing protein E3 holds potential for application in diagnostic development and disease monitoring:

    a) Serological Diagnostics:

    • Development of ELISA assays using recombinant E3 protein to detect anti-EHV-2 antibodies

    • Differential diagnosis between EHV-2 and other equine herpesvirus infections

    • Monitoring seroconversion and antibody titers in horse populations

    b) Strain-Specific Diagnostics:

    • Design of PCR primers targeting E3 gene for molecular detection

    • Development of strain-typing assays based on sequence variations in the E3 gene

    • Correlation of specific E3 variants with clinical presentations

    c) Disease Association Studies:

    • Investigation of E3 protein presence in specific conditions like pulmonary fibrosis

    • Analysis of E3 variants in horses with different clinical manifestations

    • Longitudinal studies correlating anti-E3 antibody levels with disease progression

    d) Methodological Considerations:

    • For ELISA development:

      • Optimization of coating conditions (concentration, buffer, pH)

      • Determination of appropriate blocking agents

      • Establishment of cutoff values using known positive and negative sera

      • Validation against gold standard methods

    • For molecular diagnostic assays:

      • Selection of conserved regions within the E3 gene for primer design

      • Optimization of PCR conditions for maximum sensitivity and specificity

      • Development of quantitative real-time PCR for viral load determination

      • Validation using clinical samples with known infection status

    Based on prevalence studies showing 77.2% of horses positive for EHV-2 in some populations, diagnostic tests should be interpreted in the context of clinical signs and other laboratory findings .

Research Methodology and Resources

  • What cell culture systems are optimal for propagating EHV-2 for recombinant protein studies?

    Optimal cell culture systems for EHV-2 propagation require specific considerations:

    a) Recommended Cell Lines:

    • RK-13 (rabbit kidney epithelial) cells are the standard for EHV-2 isolation and propagation

    • Equine dermal fibroblasts may provide a more native environment

    • Equine peripheral blood mononuclear cells (PBMCs) for specific studies as EHV-2 is latent in B lymphocytes

    b) Culture Conditions:

    • Maintenance at 37°C in an atmosphere of 5% CO₂

    • Extended incubation periods (7+ days) due to slow viral growth

    • Multiple blind passages may be necessary for initial isolation

    • Monitoring for cytopathic effects (CPE) which may be subtle

    c) Infection Protocol:

    • Inoculation of confluent cell monolayers

    • Adsorption period of 1 hour at 37°C

    • Maintenance medium with reduced serum (2-5%)

    • Harvesting typically occurs when 70-80% CPE is observed

    d) Virus Stock Production:

    • Freeze-thaw cycles (typically three) to release virions

    • Clarification by low-speed centrifugation (3000 × g)

    • Concentration by ultracentrifugation (14000 × g)

    • Resuspension in appropriate buffer and storage at -80°C

    e) Quality Control Measures:

    • Confirmation of viral identity through PCR or immunofluorescence

    • Titration to determine infectious units

    • Testing for contaminants (bacteria, fungi, mycoplasma, other viruses)

    • Genomic analysis to confirm strain identity

  • How can researchers design effective experiments to study EHV-2 E3 protein interactions with host immune factors?

    Designing effective experiments to study EHV-2 E3 protein interactions with host immune factors requires a systematic approach:

    a) Preliminary Binding Partner Identification:

    • Protein-protein interaction screening (yeast two-hybrid, pull-down assays)

    • Co-immunoprecipitation coupled with mass spectrometry

    • Computational prediction based on structural homology with known SUSHI domain proteins

    • Literature review of host factors interacting with similar viral proteins

    b) Interaction Validation and Characterization:

    MethodApplicationAdvantagesLimitations
    Surface Plasmon ResonanceBinding kinetics measurementReal-time, label-free, quantitativeRequires purified proteins
    ELISA-based binding assaysHigh-throughput screeningSimple setup, quantitativeMay miss low-affinity interactions
    Co-localization microscopyCellular context visualizationPreserves spatial informationCorrelation not causation
    FRET/BRETReal-time interaction in living cellsDynamic interaction monitoringComplex setup and interpretation
    AlphaScreenSolution-phase detectionHigh sensitivity, no washing stepsSpecialized equipment required

    c) Functional Consequence Assessment:

    • Complement activation/inhibition assays

    • Virus neutralization assays in the presence of complement

    • Immune cell activation/inhibition studies

    • Gene expression analysis in target cells

    d) Experimental Controls:

    • SUSHI domain-containing proteins from other viruses

    • Mutated E3 proteins (site-directed mutagenesis of key residues)

    • Host SUSHI domain proteins as comparative controls

    • Cell lines with knocked-out immune factors

    e) Data Analysis and Interpretation:

    • Statistical analysis appropriate for experimental design

    • Correlation with phylogenetic data

    • Integration with structural information

    • Comparative analysis with other viral immune evasion strategies

  • What research questions remain unanswered about EHV-2 E3 protein and what approaches could address these gaps?

    Several important research questions about EHV-2 SUSHI domain-containing protein E3 remain unanswered:

    a) Functional Role in Viral Pathogenesis:

    • Question: What is the specific function of E3 in EHV-2 infection and pathogenesis?

    • Approach: Generate E3-knockout mutants using BAC mutagenesis and compare with wild-type virus in infection models

    • Methods: Monitor viral replication, spread, immune response, and disease manifestations in equine cell cultures and potentially in animal models

    b) Host Factor Interactions:

    • Question: Which specific host factors does E3 interact with to modulate immune responses?

    • Approach: Comprehensive interactome analysis using proximity labeling (BioID, APEX) followed by mass spectrometry

    • Methods: Express tagged E3 in relevant equine cells, identify proximal proteins, validate interactions, and assess functional consequences

    c) Strain Variation Impact:

    • Question: How do sequence variations in E3 across different EHV-2 strains affect protein function?

    • Approach: Comparative functional analysis of E3 variants from multiple isolates

    • Methods: Clone and express E3 variants, assess binding to identified host factors, evaluate immune evasion capabilities

    d) Structural Determinants of Function:

    • Question: Which structural elements of E3 are critical for its function?

    • Approach: Structure-function analysis through systematic mutagenesis

    • Methods: Solve protein structure through crystallography or cryo-EM, perform alanine scanning mutagenesis, correlate structural features with functional outcomes

    e) Latency and Reactivation Role:

    • Question: Does E3 play a role in establishing latency or virus reactivation?

    • Approach: Temporal expression analysis during different phases of infection

    • Methods: Develop latency models in equine B lymphocytes, monitor E3 expression during latency establishment and reactivation

    f) Therapeutic Target Potential:

    • Question: Could E3 serve as a target for antiviral intervention?

    • Approach: High-throughput screening for small molecule inhibitors of E3 function

    • Methods: Develop binding or functional assays suitable for screening, identify compounds that disrupt E3-host interactions, validate in infection models

    Addressing these questions would significantly advance our understanding of EHV-2 biology and potentially inform new diagnostic and therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.