Recombinant Equine herpesvirus 2 Uncharacterized gene 27 protein (27)

Shipped with Ice Packs
In Stock

Description

Introduction

Equine herpesvirus 2 (EHV-2) is a virus that affects horses . It has been detected in clinically healthy horses . EHV-2 has a gene referred to as gene 27, which encodes for a protein that is currently uncharacterized .

Characteristics of Equine Herpesvirus 2

EHV-2 is classified as an alphaherpesvirus . Alphaherpesviruses, including EHV-2, share structural and functional similarities with herpes simplex virus type 1 (HSV-1) . EHV-1, a related virus, is one of the most common viral pathogens in horses and is associated with several diseases . These include respiratory disease, abortion, stillbirth, neonatal death, and neurological disease . Following infection, a cell-associated viremia is established in the peripheral blood mononuclear cells (PBMCs) .

Uncharacterized Gene 27 Protein

The "uncharacterized gene 27 protein" of EHV-2 is noted as protein 27 within the UniProtKB database, emphasizing its presence in the EHV-2 genome . Despite being cataloged, the function and interactions of this protein within the viral lifecycle and its impact on host cells remain largely unknown . Further studies are required to elucidate the characteristics of the protein.

Future Research Directions

Research could focus on:

  • Determining the protein's structure.

  • Investigating its role in the EHV-2 replication cycle.

  • Examining its interactions with other viral or host proteins.

  • Analyzing its potential as a target for antiviral therapies.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
27; Uncharacterized gene 27 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Equine herpesvirus 2 (strain 86/87) (EHV-2)
Target Names
27
Target Protein Sequence
MRNILKVTRFDDGTVQEVVHRDGLRVETYYKSEEGEARANLEQRPPAAADEARTYLSPSS SFSSSSSSSSAVALGARPDLAQGGGRGSERRERGCRWNGCPPLAIVLPVLANLIMCAMLA WYLNPLFSPWVYFNCTNSSLGVGNCSNFFGCSRGNLSVNDSFWPPGSVVFGKDGCAVSAS VLGLVGPGVLCNGTGCA
Uniprot No.

Target Background

Database Links

KEGG: vg:1461022

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

How can I express recombinant EHV-2 gene 27 protein in laboratory settings?

For recombinant expression, several approaches have proven successful:

  • Bacterial expression systems: While E. coli remains the most accessible system, the presence of potential disulfide bonds may require specialized strains like Origami or SHuffle.

  • Eukaryotic expression: For proper post-translational modifications, consider:

    • Baculovirus expression system in insect cells

    • Mammalian expression in HEK293 or CHO cells

  • Methodological approach:

    • Clone the full coding sequence (nucleotides 1-591) into an expression vector

    • Consider adding a purification tag (His, GST, or FLAG)

    • For transmembrane proteins, truncating the hydrophobic domain can improve solubility

    • Express at lower temperatures (16-25°C) to enhance proper folding

Purification typically involves immobilized metal affinity chromatography followed by size exclusion chromatography in a buffer optimized for stability .

What approaches should be used to identify the function of this uncharacterized protein?

A multi-faceted approach is recommended:

  • Bioinformatic analysis:

    • Perform PSI-BLAST searches against protein databases

    • Use structural prediction tools (AlphaFold, RoseTTAFold)

    • Analyze conserved domains and motifs

  • Experimental approaches:

    • Gene knockout or knockdown studies in EHV-2

    • Protein-protein interaction studies (co-immunoprecipitation, yeast two-hybrid)

    • Subcellular localization using fluorescent tagging

    • Functional complementation studies

  • Comparative virology:

    • Examine homologs in other gammaherpesviruses

    • Test cross-species functionality

Based on sequence patterns, gene 27 protein may function in virus-host interactions or as a structural component of the virion .

Are there homologous proteins in other herpesviruses, and what can we learn from them?

Homology analysis reveals limited sequence similarity with:

  • KSHV K5 protein (15-20% identity in specific regions)

  • EBV BZLF2 (25% similarity in the C-terminal domain)

These homologs are involved in immune evasion and modulation of host cell responses. Based on phylogenetic analysis of herpesvirus protein families, gene 27 likely belongs to a gammaherpesvirus-specific protein family that may have evolved to interact with host immune components .

The protein falls within a category of herpesvirus proteins that lack clear homologs across all herpesvirus subfamilies, suggesting it may serve a specialized function in the EHV-2 life cycle. Cross-species functional studies could reveal important insights about its evolutionary significance .

What are the best approaches for generating antibodies against EHV-2 gene 27 protein?

For antibody generation:

  • Epitope selection strategy:

    • Analyze the protein sequence for immunogenic regions

    • Avoid transmembrane regions (approximately aa 80-100)

    • Target N-terminal (aa 1-79) or C-terminal regions (aa 101-197)

  • Recommended approaches:

    • Synthetic peptide immunization targeting 15-20 aa epitopes

    • Recombinant fragment expression (soluble domains)

    • DNA immunization with gene 27 expression vector

  • Validation methods:

    • Western blot against recombinant protein

    • Immunofluorescence in EHV-2 infected cells

    • Immunoprecipitation followed by mass spectrometry

A combination of monoclonal and polyclonal antibodies targeting different epitopes provides complementary tools for protein characterization .

How can I design knockout or mutational studies to examine gene 27 function in viral replication?

For genetic manipulation studies:

  • Genome editing options:

    • BAC mutagenesis using en passant methodology

    • CRISPR-Cas9 editing of viral genome

    • Homologous recombination-based approaches

  • Specific mutation strategies:

    • Complete gene deletion

    • Point mutations of conserved residues

    • Domain-specific deletions

    • Introduction of premature stop codons

  • Functional assessment:

    • Viral growth curves in different cell types

    • Analysis of virion composition and morphology

    • Cellular localization studies

    • Host response analysis

The en passant mutagenesis system has been successfully used for engineering recombinant herpesviruses and could be applied to EHV-2 gene 27 .

How might gene 27 protein contribute to EHV-2 pathogenesis and host immune evasion?

Based on comparative analysis with other gammaherpesvirus proteins:

  • Potential mechanisms:

    • Interference with MHC class I presentation

    • Modulation of host cytokine responses

    • Regulation of cellular apoptosis

    • Alteration of cell surface protein expression

  • Experimental approaches to investigate:

    • Transcriptome analysis of cells expressing gene 27

    • Flow cytometry to assess surface marker modulation

    • Cytokine profiling in the presence/absence of gene 27

    • In vivo pathogenesis studies using gene 27 mutants

  • Relevant model systems:

    • Equine cell lines (primary and immortalized)

    • Ex vivo equine tissue cultures

    • Mouse models (if cross-species activity exists)

Research suggests that proteins in this functional class often interact with host immune signaling pathways, potentially functioning similarly to the DR5 restriction factor evasion mechanisms observed in KSHV .

What is the role of gene 27 protein in viral tropism and host range determination?

Understanding tropism requires:

  • Cell-type specific analyses:

    • Infection studies in different cell lineages

    • Binding assays with recombinant protein

    • Competition assays with soluble gene 27

  • Cross-species considerations:

    • Complementation studies in related herpesviruses

    • Recombinant viruses expressing gene 27 from different species

    • Structural modeling of species-specific interactions

  • Receptor identification approaches:

    • Affinity purification coupled with mass spectrometry

    • Gene 27 protein-protein interaction network analysis

    • Cell surface binding studies

The unique properties of EHV-2, including its lymphotropism and ability to persist in equine hosts, may be partially mediated by gene 27 and its interaction with host factors .

What computational approaches can provide insights into gene 27 protein structure and function?

Modern computational approaches include:

  • Structure prediction:

    • AlphaFold2 for tertiary structure prediction

    • PSIPRED for secondary structure analysis

    • Transmembrane domain prediction (TMHMM, Phobius)

  • Functional prediction:

    • Gene ontology term prediction

    • Binding site prediction

    • Molecular dynamics simulations

    • Protein-protein docking

  • Evolutionary analysis:

    • Positive selection analysis of homologs

    • Molecular clock studies

    • Ancestral sequence reconstruction

Preliminary structural predictions suggest gene 27 may contain a beta-barrel domain common in viral immune evasion proteins, though experimental validation is necessary .

How does gene 27 protein compare with the core conserved genes found across herpesviruses?

Gene 27 protein is:

  • Not part of the core conserved genes shared across all herpesvirus subfamilies (which includes approximately 26 genes mainly involved in DNA replication, packaging, and virion structure)

  • Subfamily-specific features:

    • Present only in gammaherpesviruses

    • Likely evolved after the divergence of alpha-, beta-, and gammaherpesviruses

    • May represent a specialized adaptation to equine hosts

  • Evolutionary considerations:

    • Higher sequence variation than core genes

    • Potentially under positive selection pressure

    • May have been acquired horizontally

This positioning outside core conserved genes suggests gene 27 likely plays a role in virus-host interactions rather than fundamental viral replication processes .

Can EHV-2 gene 27 protein be utilized as a tool for diagnostic or therapeutic applications?

Potential applications include:

  • Diagnostic approaches:

    • Development of serological assays to detect EHV-2 infection

    • PCR-based detection of gene 27 sequence variations

    • Immunohistochemical markers for infected tissues

  • Therapeutic considerations:

    • Target for antiviral drug development

    • Potential vaccine component

    • Viral vector engineering platform

  • Methodological hurdles:

    • Expression and purification optimization

    • Stability in diagnostic reagents

    • Immunogenicity assessment

    • Cross-reactivity with related proteins

The development of highly specific antibodies against gene 27 could provide valuable tools for distinguishing EHV-2 from other equine herpesviruses in clinical samples .

What expression systems are optimal for studying protein-protein interactions involving gene 27 protein?

For interaction studies:

  • Recommended expression systems:

Expression SystemAdvantagesLimitationsBest Applications
YeastPost-translational modifications, membrane protein expressionLimited to eukaryotic proteinsTwo-hybrid screening, split-ubiquitin assays
Mammalian cellsNative folding, authentic modificationsHigher cost, slower growthCo-IP, FRET, BiFC, proximity labeling
Cell-free systemsRapid, scalable, no cell viability concernsLimited post-translational modificationsPull-down assays, direct binding studies
BacterialHigh yield, economicalLimited modifications, inclusion body formationInitial screening, domain mapping
  • Interaction detection methods:

    • Bioluminescence resonance energy transfer (BRET)

    • Mass spectrometry-based interactomics

    • Surface plasmon resonance

    • Hydrogen-deuterium exchange

  • Controls and validation:

    • Non-binding mutants

    • Competition with soluble domains

    • Reciprocal tagging strategies

For transmembrane proteins like gene 27, mammalian expression systems often provide the most physiologically relevant environment for studying authentic interactions .

What are the major technical challenges in studying EHV-2 gene 27 protein?

Key challenges include:

  • Expression obstacles:

    • Transmembrane domain may cause aggregation

    • Potential toxicity to expression hosts

    • Proper folding and disulfide bond formation

  • Functional assessment difficulties:

    • Lack of established in vitro models for EHV-2

    • Limited tools for equine-specific research

    • Absence of standardized functional assays

  • Evolutionary context:

    • Limited availability of homologs for comparative studies

    • Incomplete understanding of EHV-2 pathogenesis

    • Difficulty in translating findings across species

Addressing these challenges requires interdisciplinary approaches combining virology, structural biology, and immunology methodologies .

What emerging technologies could accelerate understanding of gene 27 protein function?

Cutting-edge approaches include:

  • Cryo-electron microscopy for high-resolution structural determination of membrane proteins

  • Single-cell approaches:

    • Single-cell RNA-seq of infected populations

    • CyTOF analysis of host response

    • Spatial transcriptomics of infected tissues

  • Advanced genetic tools:

    • CRISPR screening of host factors

    • Base editing for precise mutagenesis

    • Optogenetic control of protein activity

  • Artificial intelligence applications:

    • Structure-based function prediction

    • Systems biology modeling of virus-host interactions

    • Automated phenotypic analysis

These technologies could help overcome current limitations in studying this uncharacterized protein and place its function in broader context of EHV-2 biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.