Recombinant Equine herpesvirus 2 Uncharacterized gene E9 protein (E9)

Shipped with Ice Packs
In Stock

Description

Potential Functional Hypotheses

While direct evidence is lacking, E9 may share functional similarities with other EHV-2 proteins:

  • Immune Modulation: Viral proteins like E1 (CC chemokine receptor) and E7 (IL-10) suppress host immune responses . E9 could interact with similar pathways.

  • Viral Replication: Structural proteins such as glycoprotein B (gB) and tegument proteins (e.g., ORF19) are critical for viral entry and assembly . E9 might contribute to these processes.

  • Latency: EHV-2 persists in latency, often in the trigeminal ganglion . E9 could regulate latent infection mechanisms, though no latency-associated transcripts were detected in NGS studies .

Limitations and Research Gaps

  • Functional Studies: No peer-reviewed studies explicitly describe E9’s role in viral infection or host interaction.

  • Structural Data: No crystallographic or cryo-EM structures are available to infer binding partners or enzymatic activity.

  • Transcript Abundance: Low expression levels in infected cells suggest E9 may play a niche role or be expressed under specific conditions (e.g., late infection stages).

Applications and Future Directions

The recombinant E9 protein serves as a tool for:

  1. Antigenic Studies: Identifying host antibodies against E9 for diagnostic assays.

  2. Vaccine Development: Assessing E9’s potential as a subunit vaccine candidate.

  3. Molecular Interactions: Mapping interactions with host proteins or viral components using pull-down assays.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
E9; Uncharacterized gene E9 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-205
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 2 (strain 86/87) (EHV-2)
Target Names
E9
Target Protein Sequence
SSTTSTTATSNGTTSTLNTTVSSVASTSTPSTESTTTTTPTTTNSSASSTSVTVASTATT SPQTNSTTSLTSPLSSTFSSTSANVSSSTTTTTSSTTKSTSSTKPKTSKNNPKTQEAGAE AAVMISLGILYLFILLLIIFVIILICFIRRRQHHQHGGGGGGQGGPMIPLDVISLESGLG ESWSSE
Uniprot No.

Target Background

Database Links

KEGG: vg:1461014

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the genomic location and basic characteristics of the E9 gene in Equine herpesvirus 2?

The E9 gene of EHV-2 is one of several open reading frames (ORFs) found in this gammaherpesvirus. While specific details about E9 remain to be fully elucidated, it likely follows patterns similar to other EHV-2 genes such as E1, which has been located within the terminal repeat elements of the viral genome . This positioning would be consistent with relatively recent acquisition during viral evolution, as observed with other non-conserved ORFs in gammaherpesviruses. The basic characterization would involve mapping its precise genomic coordinates and analyzing its nucleotide and predicted amino acid sequences to identify potential functional domains or motifs.

How can I confirm E9 gene expression during EHV-2 infection?

To confirm E9 gene expression, researchers should employ RT-PCR analysis similar to methods used for detecting other EHV-2 genes. This involves:

  • Infecting appropriate equine cell lines (such as equine embryonic kidney cells) with EHV-2

  • Harvesting cells after development of cytopathic effects (typically 5 days post-infection)

  • Extracting poly(A)+ RNA using guanidine thiocyanate-based methods or similar protocols

  • Performing reverse transcription using oligo(dT) primers

  • Amplifying E9-specific cDNA using E9-specific primers in PCR

  • Visualizing products on agarose gel with ethidium bromide staining

This methodology has successfully demonstrated expression of other EHV-2 genes such as E1 in infected cells, and would be appropriate for E9 as well .

What molecular techniques are optimal for DNA extraction and PCR detection of EHV-2 genes including E9?

For efficient detection of EHV-2 genes including E9, the following validated protocol is recommended:

  • Extract genomic DNA from clinical samples (whole blood, lung tissues, or nasal swabs) using a commercial kit such as the DNeasy Blood and Tissue Kit

  • Measure DNA quality and quantity using spectrophotometry (e.g., NanoDrop™)

  • Perform PCR targeting conserved sequences, such as the glycoprotein B gene, initially for virus detection

  • Design specific primers for E9 amplification based on available sequence data

  • Optimize PCR conditions including annealing temperature and cycle numbers

  • Include appropriate negative controls (samples without DNA) in each PCR reaction

This approach has been effectively used for detecting and characterizing other EHV genes and would be applicable to E9 research .

What are the optimal conditions for cloning the E9 gene for recombinant protein production?

For efficient cloning of the E9 gene, follow these research-validated steps:

  • Amplify the E9 ORF using high-fidelity DNA polymerase and primers containing appropriate restriction sites

  • Purify the amplified fragments using gel extraction (QIAquick Gel Extraction Kit or equivalent)

  • Insert the purified fragments into an appropriate expression vector (such as pDrive vector)

  • Transform the construct into competent E. coli cells (such as DH5α)

  • Incubate at 37°C overnight and select transformants

  • Extract plasmid DNA using a Plasmid Miniprep Kit

  • Verify the insert by restriction digestion and sequencing

This methodological approach has been successfully applied to other EHV-2 genes and should be effective for E9 cloning as well .

Which expression systems are most suitable for producing functional recombinant E9 protein?

The selection of an expression system depends on the anticipated characteristics of E9 protein. Based on research with other herpesvirus proteins:

Expression SystemAdvantagesLimitationsBest Used For
E. coliFast growth, high yields, low costLimited post-translational modificationsInitial structural studies, antibody production
Insect cells (Baculovirus)Eukaryotic post-translational modifications, moderate to high yieldsMore complex than bacterial systemsFunctional studies requiring proper folding
Mammalian cellsNative-like post-translational modificationsLower yields, higher costFunctional studies, protein-protein interactions
Cell-free systemsRapid production, amenable to difficult proteinsLimited scale, higher costInitial screening, structural studies

The choice should be guided by the specific research questions and anticipated structural or functional properties of E9. For viral envelope proteins or those requiring complex folding, mammalian or insect cell systems would be preferable .

How can I determine if E9 protein interacts with host cellular components?

To investigate potential interactions between E9 protein and host cellular components, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Express tagged E9 protein in equine cells, immunoprecipitate with anti-tag antibodies, and identify binding partners by mass spectrometry

  • Yeast two-hybrid screening: Use E9 as bait to screen an equine cDNA library

  • Proximity labeling methods: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to E9 in living cells

  • Surface plasmon resonance (SPR): Measure direct binding of purified E9 to candidate cellular proteins

  • Fluorescence microscopy: Use fluorescently-tagged E9 to observe colocalization with cellular structures or proteins

Similar approaches have revealed that other EHV-2 proteins, such as E1, interact with host components like chemokine receptors, suggesting E9 may also have specific host targets .

What techniques can reveal if E9 functions as an immune evasion protein like other herpesvirus proteins?

To investigate potential immune evasion functions of E9, consider these research approaches:

  • MHC-I surface expression assays: Measure MHC-I levels on cells expressing E9 using flow cytometry

  • Antigen presentation assays: Assess whether E9 expression affects presentation of model antigens

  • Proteasome activity assays: Determine if E9 modulates proteasomal degradation of cellular proteins

  • Cytokine profiling: Examine if E9 alters cytokine production using multiplex assays

  • NFκB pathway analysis: Investigate if E9 affects NFκB signaling using reporter assays

  • Immunoprecipitation of TAP components: Test if E9 interacts with antigen processing machinery

These approaches are based on research demonstrating that herpesviruses often encode proteins that modulate host immune responses, as seen with other viral proteins like UL49.5 that affects the transporter associated with antigen processing (TAP) .

How conserved is the E9 gene across different EHV-2 isolates and related gammaherpesviruses?

To assess conservation of E9, researchers should:

  • Collect E9 sequences from multiple EHV-2 isolates from different geographical regions

  • Identify potential homologs in related viruses using BLAST and other sequence analysis tools

  • Perform multiple sequence alignment to identify conserved regions

  • Calculate nucleotide and amino acid sequence identities

  • Conduct phylogenetic analysis to determine evolutionary relationships

  • Identify selection pressures using dN/dS ratio analysis

This approach will help determine whether E9 is a core conserved herpesvirus gene or a more recently acquired ORF. Based on patterns observed with other EHV-2 genes, if E9 shows high conservation, it likely serves an essential function, whereas if it's poorly conserved, it may have species-specific modulatory roles .

What bioinformatic approaches can predict potential functions of E9 based on sequence homology?

For predicting E9 protein functions, employ these bioinformatic strategies:

  • Protein domain prediction: Use tools like PFAM, SMART, and InterProScan to identify known functional domains

  • Secondary structure prediction: Utilize PSIPRED or JPred to predict structural elements

  • Homology modeling: If homologs with known structures exist, create 3D models using tools like SWISS-MODEL

  • Subcellular localization prediction: Use TargetP, TMHMM, and SignalP to predict cellular targeting

  • Post-translational modification sites: Identify potential glycosylation, phosphorylation, or ubiquitination sites

  • Molecular docking: Predict interactions with candidate ligands or receptors

These analyses can provide initial hypotheses about E9 function that can guide experimental design. Similar approaches have helped characterize other viral proteins, such as identifying the E1 ORF of EHV-2 as a G protein-coupled receptor homolog with 31-47% amino acid identity to known CC chemokine receptors .

How can CRISPR-Cas9 technology be utilized to study E9 protein function?

CRISPR-Cas9 technology offers powerful approaches to study E9 function:

  • Gene knockout in viral genome: Delete the E9 gene from the EHV-2 genome to assess its role in viral replication and pathogenesis

  • Domain mutagenesis: Introduce specific mutations to functionally important domains identified through bioinformatic analysis

  • Tagging at endogenous locus: Add epitope or fluorescent tags to study localization and interactions of E9 at physiological expression levels

  • Cellular factor screening: Conduct genome-wide CRISPR screens to identify host factors that interact with E9, similar to screens that identified CRL2 as critical for UL49.5-triggered TAP degradation

  • Inducible expression systems: Create cell lines with doxycycline-inducible E9 expression to study immediate effects of the protein

When applying these techniques, researchers should include appropriate controls and validate findings using complementary approaches .

What are the challenges in studying potential roles of E9 in EHV-2 pathogenesis and immune modulation?

Researchers face several methodological challenges when investigating E9's role:

  • Establishing appropriate in vitro models: Determining which equine cell types best recapitulate in vivo infection contexts

  • Developing specific antibodies: Generating highly specific antibodies against E9 for detection and functional studies

  • Creating mutant viruses: Constructing and validating E9-deficient EHV-2 strains

  • Quantifying subtle phenotypes: Detecting potentially modest effects on viral fitness or immune modulation

  • Translating in vitro findings to in vivo relevance: Establishing animal models that accurately reflect natural infection

  • Distinguishing direct from indirect effects: Determining whether observed phenotypes are directly attributable to E9

These challenges parallel those faced when studying other EHV-2 genes like E1, which required careful experimental design to identify its ligand (eotaxin) and demonstrate its function as a chemokine receptor .

What is the optimal experimental design to determine if E9 affects viral replication kinetics?

To rigorously assess E9's impact on viral replication:

  • Generate matched viral strains: Create E9-knockout (ΔE9) and wild-type (WT) viruses in the same genetic background

  • Perform multi-step growth curves: Infect equine cells at low MOI (0.01) and measure viral titers at multiple timepoints (12, 24, 48, 72, 96, 120 hours post-infection)

  • Single-step growth curves: Infect at high MOI (5-10) to assess replication independent of cell-to-cell spread

  • Quantify viral components: Measure viral DNA, RNA, and protein levels using qPCR, RT-qPCR, and Western blotting

  • Assess in multiple cell types: Test replication in different equine cell lines and primary cells

  • Examine plaque morphology: Evaluate cell-to-cell spread through plaque size measurements

This comprehensive approach will help determine whether E9 affects early or late stages of the viral lifecycle .

How should researchers address conflicting data when characterizing novel functions of E9?

When faced with contradictory results during E9 characterization:

  • Validate reagents: Confirm specificity of antibodies and functionality of recombinant proteins

  • Control for expression levels: Ensure comparable expression levels across experimental systems

  • Test multiple cell lines: Determine if contradictions are cell-type specific

  • Examine viral strain differences: Test whether observed functions vary among different EHV-2 isolates

  • Employ complementary techniques: Validate findings using independent methodological approaches

  • Consider protein partners: Investigate whether contradictions result from differential expression of cellular cofactors

  • Temporal considerations: Assess whether contradictory functions occur at different times post-infection

Careful attention to these factors has resolved contradictions in studies of other herpesvirus proteins, and should be applied to E9 research .

What emerging technologies could advance understanding of E9 protein structure and function?

Several cutting-edge technologies hold promise for E9 research:

  • Cryo-electron microscopy: Determine high-resolution structures of E9 alone or in complexes

  • AlphaFold and other AI-based structure prediction: Generate structural models to guide functional studies

  • Proximity-dependent biotinylation (BioID/TurboID): Identify E9's protein interaction network in living cells

  • Single-cell RNA-seq: Profile transcriptional changes induced by E9 expression at single-cell resolution

  • CRISPR activation/interference screens: Identify host factors that modulate E9 function

  • Nanobody development: Generate high-affinity, small-format antibodies for functional blockade and imaging

  • Organoid models: Test E9 function in more physiologically relevant three-dimensional culture systems

Application of these technologies would parallel recent advances in understanding other viral proteins, potentially revealing unexpected functions of E9 .

How can researchers develop a systematic approach to characterize potential immune evasion strategies of E9?

A comprehensive approach to investigate E9's potential immune modulatory functions should include:

  • Innate immunity assessment:

    • Measure type I/III interferon responses in presence/absence of E9

    • Evaluate activation of pattern recognition receptors

    • Assess NK cell activation and function

  • Adaptive immunity examination:

    • Monitor antigen presentation pathway components

    • Measure T cell activation in co-culture systems

    • Evaluate antibody responses in animal models

  • Signaling pathway analysis:

    • Screen for effects on NF-κB, JAK-STAT, and MAPK pathways

    • Identify potential antagonism of specific immune signaling molecules

    • Perform phosphoproteomics to detect altered signaling

This systematic approach would build on knowledge of immune evasion strategies employed by other herpesvirus proteins, potentially revealing novel mechanisms employed by E9 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.