Recombinant Equine herpesvirus 4 Envelope glycoprotein E (gE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gE; Envelope glycoprotein E; gE; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)
Target Names
gE
Target Protein Sequence
GSTWPSRCHSTLLGDRPHFIQPAPNRVDLLFKDIPESATGLYVFVLLYNGHPEAWTYTLL STANHFMNVLTDRTRPRLGEHFYTDHGHQLFTPHPSEATTQELGAWTRHYLAFLLIIICT CAALLIALVVWGCILYIRSNRKPYEVLNPFETVYTSVPSNDPTDEVLVFERLASDSDDSF DSSSDEELELPQPPPAAQLQPYSSLESADASRGRSGFKVWFRDTPEASPEPLHRPTPPVG PDYSKVASKLRSILK
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is crucial for cell-to-cell viral spread. It facilitates the targeting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional cellular receptors. This mechanism is implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for anterograde spread of infection throughout the nervous system. In conjunction with US9, gE/gI participates in the sorting and transport of viral structural components towards axon terminals.

Protein Families
Alphaherpesvirinae glycoprotein E family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass membrane protein. Host endosome membrane; Single-pass membrane protein.

Q&A

How does EHV-4 gE compare structurally and functionally to other herpesvirus gE proteins?

While EHV-4 gE shares fundamental features with other alphaherpesvirus gE proteins, comparative analysis has revealed important differences. The gE-gI complex in herpesviruses typically facilitates cell-to-cell spread, allowing the virus to avoid neutralizing antibodies in the extracellular space.

EHV-4 gE shows moderate sequence homology to EHV-1 gE (approximately 77% amino acid identity, similar to the identity level between their gD homologues). Functional studies suggest that EHV-4 gE, like other herpesvirus gE proteins, forms a complex with gI that contributes to the viral cell-to-cell spread but may have evolved specific functions for equine cell tropism .

What are the optimal methods for producing recombinant EHV-4 gE for research purposes?

Recombinant EHV-4 gE can be efficiently produced using the following protocol:

  • Expression System Selection: E. coli is commonly used for producing recombinant EHV-4 gE with N-terminal His-tag for purification purposes .

  • Plasmid Construction: The full-length (1-255 aa) or fragment of the gE gene sequence should be PCR-amplified from EHV-4 DNA using primers containing appropriate restriction sites. The amplified fragment is then cloned into a suitable expression vector (e.g., pET series vectors).

  • Protein Expression Conditions:

    • Transformation into E. coli BL21(DE3) or similar strains

    • Culture growth to OD600 0.6-0.8 at 37°C

    • Induction with 0.5-1 mM IPTG

    • Post-induction growth at lower temperature (16-25°C) for 4-18 hours to improve solubility

  • Purification Strategy:

    • Bacterial cell lysis under native or denaturing conditions depending on protein solubility

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin

    • Optional secondary purification by ion exchange or size exclusion chromatography

    • Final purity should exceed 90% as determined by SDS-PAGE

  • Storage: Store purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What challenges are encountered when expressing EHV-4 gE in different expression systems?

Expression of EHV-4 gE presents several system-specific challenges:

Expression SystemAdvantagesChallengesSolutions
E. coliHigh yield, cost-effective, simple manipulationLack of post-translational modifications, potential inclusion body formationOptimize codons, use solubility tags, express at lower temperatures (16-25°C)
Insect cellsPost-translational modifications, higher solubilityMore complex, time-consuming, lower yield than E. coliUse specialized vectors (e.g., baculovirus), optimize transfection conditions
Mammalian cellsNative-like glycosylation, proper foldingLowest yield, highest cost, technical complexityUse stable cell lines, optimize serum-free media formulations

The native EHV-4 gE is 95 kDa in infected cells , whereas recombinant gE expressed in E. coli produces a smaller protein due to the absence of glycosylation. For structural studies requiring glycosylation-free protein, E. coli expression is preferred, while functional studies may benefit from expression in eukaryotic systems that provide appropriate post-translational modifications .

How can recombinant EHV-4 gE be used to study viral entry mechanisms in equine cells?

Recombinant EHV-4 gE can be used in several experimental approaches to study viral entry:

  • Competitive inhibition assays: Preincubate equine dermal (ED) cells with varying concentrations of purified recombinant gE protein (0-150 μg/ml) for 1 hour on ice, followed by infection with EHV-4 expressing GFP. This approach reveals whether gE is involved in initial attachment/entry by measuring reduction in infection via flow cytometry .

  • Plaque reduction assays: Similar to competitive inhibition but using plaque counting as the readout. ED cells are incubated with recombinant gE (150 μg/ml) for 1 hour, then infected with 100 PFU of EHV-4. After incubation, analyze GFP-positive plaques to quantify inhibition .

  • Surface plasmon resonance (SPR) studies: Immobilize potential cellular receptors on SPR chips and measure binding kinetics with recombinant gE to identify interactions and determine dissociation constants (KD) .

  • CRISPR-Cas9 knockout/knockdown approaches: Create equine cell lines with reduced or eliminated gE receptor expression, then evaluate whether recombinant gE still binds to these cells using flow cytometry or immunofluorescence.

Research by Azab et al. demonstrated similar approaches with other glycoproteins that could be applied to gE studies, showing that glycoproteins can block viral entry in a dose-dependent manner .

What role does the gE-gI complex play in EHV-4 cell-to-cell spread compared to other viral glycoproteins?

The gE-gI heterodimer in alphaherpesviruses facilitates direct cell-to-cell spread, allowing viruses to avoid neutralizing antibodies in the extracellular space. Research methods to study this function include:

  • Generation of gE-deleted mutants: Using bacterial artificial chromosome (BAC) technology to create EHV-4 variants lacking gE (ΔgE) and evaluate effects on plaque size, growth kinetics, and cell-to-cell spread .

  • Trans-complementation assays: Expressing gE in trans in gE-negative cell lines to rescue phenotypes and confirm specific roles.

  • Fluorescence microscopy: Using time-lapse fluorescence microscopy with labeled virus particles to track viral movement between cells in the presence/absence of gE-specific antibodies.

Studies with EHV-4 gE should consider comparative experiments with other glycoproteins:

  • gB and gH are essential for viral replication

  • gH deletion in EHV-1 completely abrogates plaque formation

  • gD is crucial for receptor binding and entry

  • gG deletion does not significantly affect viral replication in vitro

Importantly, while some glycoproteins (e.g., gH) show significant effects on plaque size when exchanged between EHV-1 and EHV-4, similar experiments with gE would provide valuable comparative data on its specific contribution to cell-to-cell spread .

How does EHV-4 gE interact with equine immune system components?

Methodological approaches to study gE-immune system interactions include:

  • Complement inhibition assays: Purified recombinant gE can be tested for its ability to interfere with complement activation pathways using hemolysis assays or C3 deposition ELISA.

  • Fc receptor binding studies: Several herpesvirus gE proteins function as viral Fc receptors that can bind the Fc portion of host antibodies. To test this for EHV-4 gE:

    • Immobilize recombinant gE on ELISA plates

    • Add equine IgG with different antigen specificity

    • Detect binding using anti-equine IgG secondary antibodies

    • Compare binding of whole IgG versus F(ab')2 fragments (which lack the Fc region)

  • Immunomodulation studies: Analyze how recombinant gE affects cytokine production by equine peripheral blood mononuclear cells using ELISAs or qPCR to measure cytokine expression.

  • Neutralizing antibody evasion: Investigate whether recombinant gE-gI complex can protect EHV-4 from neutralizing antibodies using in vitro neutralization assays.

Based on studies of other alphaherpesvirus gE proteins, EHV-4 gE likely contributes to immune evasion strategies, potentially by interfering with antibody-dependent cellular cytotoxicity or complement activation .

What are the key cellular receptors that interact with EHV-4 gE during infection?

While the search results don't specifically identify receptors for EHV-4 gE, relevant experimental approaches to identify potential receptors include:

  • Co-immunoprecipitation assays: Use purified recombinant gE protein with a tag (e.g., His-tag) to pull down interacting cellular proteins from equine cell lysates, followed by mass spectrometry to identify binding partners.

  • Yeast two-hybrid screening: Screen equine cDNA libraries to identify proteins that interact with gE.

  • Surface plasmon resonance (SPR): Test binding of recombinant gE to candidate receptors immobilized on SPR chips to determine binding kinetics and affinity.

  • Comparative analysis with known alphaherpesvirus gE receptors: Test interaction with equine homologs of receptors identified for other herpesvirus gE proteins.

Research on other EHV-4 glycoproteins has shown that:

  • gD interacts with equine MHC-I molecules as an entry receptor

  • gD binding to MHC-I requires specific residues (F213 and D261) that are important for virus binding

  • gH plays a role in membrane fusion processes

Cross-blocking studies using other glycoproteins could determine if gE shares or competes for the same cellular receptors as these other viral proteins .

How do the functions of EHV-4 gE differ from EHV-1 gE in viral pathogenesis?

To investigate functional differences between EHV-4 gE and EHV-1 gE, researchers can employ:

  • Gene exchange experiments: Generate recombinant viruses where gE genes are exchanged between EHV-1 and EHV-4 using bacterial artificial chromosome (BAC) technology, similar to studies performed with gD and gH . Compare:

    • Growth kinetics in different cell types

    • Plaque morphology and size

    • Cell tropism

    • Viral shedding patterns

    • Immune response evasion capabilities

  • Chimeric protein construction: Create chimeric proteins containing domains from both EHV-1 and EHV-4 gE to map functional domains specific to each virus.

  • Animal infection studies: Compare pathogenesis of wild-type versus gE-exchanged viruses in vivo.

While EHV-1 and EHV-4 share high genetic similarity (individual proteins 55-96% identical), their pathogenesis differs significantly:

  • EHV-1 can cause respiratory disease, abortion, and neurological disorders

  • EHV-4 primarily causes upper respiratory tract disease with rare progression to abortion

  • EHV-1 establishes viremia and can infect endothelial cells of blood vessels in the nervous system and uterus

  • EHV-4 rarely becomes viremic

These differences in pathogenicity are likely related to variations in viral glycoproteins, including potential differences in gE function that could be explored through the methods described above .

How has EHV-4 gE evolved across different EHV-4 strains and compared to other equine herpesviruses?

Methodological approaches to study evolutionary aspects of EHV-4 gE include:

  • Phylogenetic analysis: Sequence gE genes from multiple isolates of EHV-4 from different geographical regions and time periods. Recent archaeological findings have identified EHV-4 in specimens dating back 3,900 years, enabling unprecedented evolutionary studies .

  • Selection pressure analysis: Calculate dN/dS ratios to identify regions under positive or negative selection pressure within the gE gene.

  • Structural modeling and comparison: Generate structural models of gE proteins from different isolates and related viruses to identify conserved functional domains.

  • Recombination analysis: Use bioinformatic tools like RDP5 to detect potential recombination events in the evolutionary history of gE genes .

The available genomic data shows that:

  • EHV-4 has evolved into two main subclades (I and II), with subclade I almost exclusively consisting of abortion isolates

  • Bayesian phylogenetic reconstruction estimates EHV-4 diversification occurred around 4,000 years ago, coinciding with the spread of modern domestic horses

  • The diversification time of the two EHV-4 subclades has been revised from the 16th century to nearly a thousand years ago based on ancient DNA evidence

  • Recombination events play a significant role in EHV-4 evolution, with at least 12 recombination events identified throughout the genome

Comparative analysis of gE sequences could reveal whether this gene carries signatures related to shifts in viral tropism or pathogenicity across EHV-4 evolution.

How can recombinant EHV-4 gE be utilized in developing improved diagnostic tests?

Recombinant EHV-4 gE can enhance diagnostic capabilities through:

  • ELISA-based antibody detection:

    • Coat ELISA plates with purified recombinant gE

    • Test equine serum samples for anti-gE antibodies

    • Compare results with tests using whole virus antigens to determine specificity and sensitivity

    • Standardize with known positive and negative control sera

  • Multiplex serological assays:

    • Couple recombinant gE to different microsphere sets in bead-based multiplex assays

    • Include multiple EHV-4 glycoproteins (gB, gC, gD, gE) to improve sensitivity

    • Differentiate between antibody responses to different viral proteins

  • Lateral flow assays:

    • Develop field-deployable rapid tests using recombinant gE combined with colloidal gold or latex particles

    • Validate against laboratory reference methods like virus neutralization tests

  • Competitive ELISA for DIVA testing:

    • Design competitive ELISAs to Differentiate Infected from Vaccinated Animals (DIVA)

    • Use recombinant gE as antigen and compete with monoclonal antibodies

    • Enable distinction between vaccination and natural infection if vaccines lack gE

Current diagnostic approaches for EHV-4 include virus isolation, PCR, and serology, with real-time qPCR being the method of choice for many diagnostic laboratories . New diagnostic tests incorporating recombinant gE could improve specificity, sensitivity, and DIVA capabilities compared to existing methods.

What is the potential of recombinant EHV-4 gE in vaccine development strategies?

Approaches to utilize recombinant gE in vaccine development include:

  • Subunit vaccine approaches:

    • Formulate purified recombinant gE with appropriate adjuvants

    • Test in combination with other glycoproteins (gB, gC, gD) that contain antibody epitopes recognized by the equine immune system

    • Evaluate humoral and cellular immune responses in vitro and in vivo

  • gE-deleted marker vaccines:

    • Create attenuated EHV-4 with gE deletion using BAC technology

    • Test for reduced virulence and ability to induce protective immunity

    • Use recombinant gE in companion diagnostic tests for DIVA strategy

  • Vectored vaccines expressing gE:

    • Express gE in viral vectors (adenovirus, Modified Vaccinia Ankara)

    • Combine with other immunogenic EHV-4 proteins

    • Evaluate safety, immunogenicity, and efficacy in horses

  • DNA vaccines encoding gE:

    • Design optimized gE expression plasmids

    • Test alone or in combination with other glycoprotein-encoding plasmids

    • Evaluate in prime-boost strategies with protein boosting

Current EHV-4 vaccines have limited efficacy, with protection typically limited in time and frequent outbreaks occurring even in vaccinated horses . Research with an EHV-1 ORF2-deleted mutant showed improved protection against challenge infection and reduced viral shedding , suggesting similar approaches could be valuable for EHV-4 vaccine development.

A randomized controlled trial would be necessary to evaluate efficacy, comparing horses vaccinated with gE-based vaccines versus conventional vaccines, followed by challenge with virulent EHV-4 to assess protection against clinical disease, viral shedding, and potential viremia.

What structural features of EHV-4 gE are critical for its function, and how can they be analyzed?

Critical structural features of EHV-4 gE can be analyzed through:

  • X-ray crystallography:

    • Express and purify recombinant gE fragments optimized for crystallization

    • Perform crystal screening and optimization

    • Collect diffraction data and solve structure

    • Compare with crystal structures of related proteins like EHV-1 gD

  • Cryo-electron microscopy (cryo-EM):

    • Study the structure of gE-gI complexes

    • Visualize gE in the context of whole virions

    • Analyze conformational changes upon receptor binding

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map regions of gE that undergo conformational changes upon binding to gI or cellular receptors

    • Identify structurally dynamic regions that might be functionally important

  • Site-directed mutagenesis and functional assays:

    • Create point mutations in key residues identified through structural analysis

    • Test mutant proteins for binding to gI, cellular receptors, and Fc regions of antibodies

    • Correlate structural features with function

While the crystal structures of EHV-1 and EHV-4 gD have been determined , showing a common V-set immunoglobulin-like (IgV-like) core comparable to other gD homologs, similar structural studies for gE would be valuable. Key structurally important residues in gD (F213 and D261) were identified as critical for virus binding through crystallography and functional studies , and comparable studies with gE could reveal similarly important structural features.

How do post-translational modifications affect the structure and function of EHV-4 gE?

Methods to investigate post-translational modifications (PTMs) of EHV-4 gE include:

  • Mass spectrometry-based PTM mapping:

    • Purify gE from infected cells or recombinant expressed in eukaryotic systems

    • Digest with proteases and analyze peptides by LC-MS/MS

    • Identify glycosylation sites, phosphorylation, and other modifications

    • Compare PTM patterns between gE from different cell types or virus strains

  • Glycosylation analysis:

    • Treat purified gE with various glycosidases (PNGase F, Endo H, neuraminidase)

    • Analyze mobility shifts by SDS-PAGE

    • Characterize glycan structures using specialized MS techniques

  • Mutagenesis of PTM sites:

    • Create recombinant gE with mutations at predicted N-glycosylation sites (N-X-S/T)

    • Express wild-type and mutant proteins in different cell systems

    • Compare folding, stability, and functional properties

  • Functional comparison of differentially modified gE:

    • Compare bacterially-expressed gE (lacking PTMs) with mammalian-expressed gE

    • Perform binding assays, cell fusion assays, and in vitro neutralization tests

    • Assess the impact of glycosylation on immunogenicity and antigenicity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.