Recombinant Equine herpesvirus 4 Envelope glycoprotein G (gG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
gG; Envelope glycoprotein G; gG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-405
Protein Length
Full Length of Mature Protein
Species
Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)
Target Names
gG
Target Protein Sequence
RLAPDDLCYAEPRKTGPMPRSKPKHQPLLFEAPKVALTAESKGCQLILLDPPIDMGYRLE DKINASIAWFFDFGNCRMPIAYREYYDCVGNAIPSPETCDGYSFTLVKTEGVVEFTIVNM SLLLQPGIYDSGSFIYSALLDMDVLTGRVILNVENDTNYPCGMTHGLTADGNINVDETTH TTPHPRAVGCFPELINFDAWENVTFEEMGIPDPNSFLDDESDYPNTMDCYSWDLYTYPKS LKQAEGPQTLLIGAVGLRILAQAWKFVENETYSQHTRTYTRDAKEVDVTQPSPVQADSVL AKKRTSMKNNPIYSEGKPHAKPFSTIDSIHTEGMKNNPVYSESLMLNVQHSDSITTGGVL HGLQDCDNQLKTVYICLALIGLAHVP
Uniprot No.

Target Background

Function
A chemokine-binding protein that inhibits neutrophil chemotaxis.
Protein Families
Alphaherpesvirinae glycoprotein G family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the molecular characterization of EHV4 glycoprotein G?

EHV4 glycoprotein G has been identified as a type-specific, secreted glycoprotein with distinct molecular properties. Research has characterized two glycoproteins in the supernatant of EHV4-infected cell cultures: a 63K and a 250K glycoprotein. The 63K glycoprotein demonstrates type-specific properties, reacting exclusively with monospecific sera from horses infected or immunized with EHV4, while showing no reactivity with sera from EHV1-infected or immunized horses . The primary translational product of EHV4 gG consists of 405 amino acids with a predicted molecular size of 44K, though post-translational modifications yield the mature 63K secreted glycoprotein . When the entire EHV4 gG gene is expressed in a bacterial expression vector (pGEX-3X), it produces a type-specific fusion protein of 70K, of which the gG portion comprises approximately 43K .

How does EHV4 gG relate structurally to glycoprotein G of other herpesviruses?

EHV4 gG shows evolutionary relationships with glycoprotein G homologs from other herpesviruses. Sequence analysis reveals that EHV4 gG shares 28% amino acid identity with pseudorabies virus (PRV) gX and 16% identity with herpes simplex virus 2 (HSV2) gG . Notably, the N-terminal region displays significantly greater identity, including the conservation of 4 cysteine residues that likely play critical roles in maintaining protein structure and function . The predicted amino acid sequence demonstrates characteristics typical of envelope glycoproteins, with an identifiable signal sequence and potential sites for N-linked glycosylation. EHV4 gG represents the third alphaherpesvirus gG homolog known to be, at least partially, secreted, following the pattern observed in related viruses .

What are the type-specific epitopes of EHV4 gG and where are they located?

Strong type-specific epitopes have been localized to the highly variable region comprising amino acids 287-382 of EHV4 gG . This region is particularly significant because it can be distinguished from the corresponding variable region (amino acids 288-350) of EHV1 gG. Fusion proteins expressing these variable regions demonstrate strong and type-specific reactivity with sera from experimentally infected foals . This specificity is crucial for serological differentiation between EHV4 and EHV1 infections, which has historically been challenging due to the extensive antigenic cross-reactivity between these closely related viruses . The identification of these type-specific epitopes provides the molecular basis for developing diagnostic tools that can differentiate between antibodies to EHV4 and EHV1.

How can recombinant EHV4 gG be optimally expressed in bacterial systems for research applications?

The expression of recombinant EHV4 gG in bacterial systems requires careful optimization of vector design and expression conditions. Research indicates that the complete EHV4 gG gene can be successfully expressed in the bacterial expression vector pGEX-3X, yielding a fusion protein of approximately 70K . The methodology involves:

  • Primer design for PCR amplification of the gG gene from viral genomic DNA, incorporating appropriate restriction sites

  • Cloning into the pGEX-3X vector, which provides a glutathione S-transferase (GST) tag

  • Transformation into an appropriate E. coli strain (typically BL21 or similar)

  • Induction of protein expression using IPTG at optimized concentrations (0.1-1.0 mM) and temperatures (16-37°C)

  • Cell lysis under native conditions

  • Purification using glutathione-agarose affinity chromatography

For applications requiring removal of the GST tag, the fusion protein can be cleaved using Factor Xa protease, followed by additional purification steps. Western blot analysis using monospecific EHV4 antisera can confirm the identity and integrity of the expressed protein .

What are the optimal parameters for developing an ELISA-based diagnostic test using recombinant EHV4 gG?

Development of an ELISA-based diagnostic test using recombinant EHV4 gG requires careful consideration of multiple parameters:

  • Antigen preparation: Recombinant fusion proteins expressing the variable region (amino acids 287-382) of EHV4 gG demonstrate optimal type-specificity

  • Plate coating: Use purified recombinant protein at concentrations of 1-5 μg/ml in carbonate-bicarbonate buffer (pH 9.6)

  • Blocking: 5% non-fat dry milk or 1% bovine serum albumin in PBS-T (0.05% Tween-20)

  • Test sera: Optimize dilutions (typically 1:100 to 1:400) in blocking buffer

  • Secondary antibody: Horse-specific IgG conjugated with horseradish peroxidase

  • Substrate: TMB (3,3',5,5'-tetramethylbenzidine) with reaction stopped using 2N H₂SO₄

  • Validation: Test against well-characterized panels of sera from:

    • Colostrum-deprived, specific-pathogen-free foals with defined EHV4/EHV1 exposure

    • Experimentally infected/immunized horses

    • Field samples with known infection status

Cut-off values should be established using receiver operating characteristic (ROC) curve analysis to optimize sensitivity and specificity. Cross-reactivity with EHV1 antibodies must be rigorously assessed to ensure type-specificity of the assay .

How can affinity purification techniques be applied to study EHV4 gG-specific antibodies?

Affinity purification of EHV4 gG-specific antibodies represents a sophisticated technique for studying the immunological properties of this glycoprotein. Research has demonstrated effective methodologies involving:

  • Preparation of affinity columns:

    • Express recombinant EHV4 gG or fusion proteins containing specific epitope regions

    • Couple purified proteins to an appropriate matrix (CNBr-activated Sepharose, NHS-activated agarose)

  • Antibody purification protocol:

    • Apply polyclonal sera to the column

    • Wash extensively to remove non-specific antibodies

    • Elute specific antibodies using acidic conditions (glycine-HCl, pH 2.5-3.0)

    • Neutralize immediately with Tris-HCl (pH 8.0)

    • Dialyze against PBS

  • Validation of purified antibodies:

    • Western blot against EHV4-infected cell lysates

    • ELISA testing against recombinant proteins

    • Immunofluorescence on infected cells

Research has shown that antibodies affinity purified from Western blots containing a 70K EHV4 gG fusion protein specifically reacted with the 63K secreted glycoprotein. Conversely, antibodies affinity purified against the 63K secreted product reacted with the 70K gG fusion protein, confirming the identity of these proteins .

How do the type-specific epitopes of EHV4 gG differ from those of EHV1 gG?

The type-specific epitopes of EHV4 gG and EHV1 gG exhibit significant differences that enable serological differentiation between infections with these closely related viruses. Comparative analysis reveals:

  • Location differences:

    • EHV4 gG: Type-specific epitopes localized to amino acids 287-382

    • EHV1 gG: Type-specific epitopes localized to amino acids 288-350

  • Sequence variation:

    • These regions represent the most variable portions of the respective glycoproteins

    • Limited sequence homology exists between the corresponding regions of EHV4 and EHV1 gG

    • The variation accounts for the type-specificity observed in serological assays

  • Immunological distinction:

    • Fusion proteins expressing these variable regions react strongly and type-specifically with well-characterized sera

    • Testing with sera from colostrum-deprived, specific-pathogen-free foals with defined infection history confirms the type-specificity

    • No significant cross-reactivity is observed between antibodies against the type-specific regions

This distinct epitope localization provides the molecular basis for developing single-well diagnostic enzyme-linked immunosorbent assays that can effectively distinguish between horses infected with EHV4, EHV1, or both viruses.

What research strategies can resolve contradictory findings about cross-reactivity between EHV4 and EHV1 glycoproteins?

Resolving contradictory findings regarding cross-reactivity between EHV4 and EHV1 glycoproteins requires systematic research strategies:

  • Standardization of reagents and methodology:

    • Use well-characterized recombinant proteins with confirmed sequences

    • Standardize expression systems to ensure consistent post-translational modifications

    • Employ multiple detection methods (ELISA, Western blot, immunofluorescence)

  • Comprehensive epitope mapping:

    • Generate overlapping peptide libraries covering the entire gG sequence

    • Test reactivity with monospecific sera against EHV4 and EHV1

    • Identify both shared and type-specific epitopes with precision

  • Use of appropriate sera panels:

    • Incorporate sera from colostrum-deprived foals with defined infection history

    • Include sequential samples from experimentally infected animals

    • Test field samples with confirmed infection status by PCR/virus isolation

  • Advanced analytical approaches:

    • Competition assays to directly assess epitope-specific binding

    • Surface plasmon resonance (SPR) to measure binding kinetics and affinities

    • Structural studies to determine epitope conformation and accessibility

Researchers should also consider factors like timing of sample collection, concurrent infections, vaccination history, and potential strain variations that might account for unexpected cross-reactivity .

How does recombinant EHV4 gG relate functionally to other glycoproteins involved in cell entry?

While EHV4 gG functions primarily as a secreted glycoprotein with diagnostic significance, its relationship to other glycoproteins involved in cell entry merits consideration. Research on equine herpesvirus glycoproteins reveals:

  • Comparative roles in virus entry:

    • Glycoprotein D (gD) is the principal receptor-binding protein that interacts with cell surface receptors like MHC-I and triggers the fusion process

    • Glycoprotein B (gB) and gC mediate initial viral attachment to heparan sulfate proteoglycans

    • The gH/gL heterodimer contributes to the fusion process

    • gG appears to function primarily in immune modulation rather than direct cell entry

  • Potential immunomodulatory functions:

    • As a secreted glycoprotein, EHV4 gG may function similarly to other herpesvirus secreted gGs

    • These typically have chemokine-binding properties that modulate host immune responses

    • The secretion of gG during infection may serve to divert antibody responses from envelope-associated glycoproteins

  • Complementary diagnostic value:

    • While gD is crucial for virus entry and can block infection when used as a recombinant protein, gG provides superior type-specific serological differentiation

    • The combination of functional studies on gD with serological studies based on gG offers complementary approaches to understanding EHV4 biology

The relationship between these glycoproteins highlights the multifaceted strategies employed by EHV4 during infection and immune evasion.

What experimental approaches can assess whether EHV4 gG functions as an immune evasion protein?

Determining whether EHV4 gG functions as an immune evasion protein requires specialized experimental approaches:

  • Chemokine binding assays:

    • Express and purify recombinant EHV4 gG

    • Conduct SPR or ELISA-based binding assays with equine chemokines

    • Perform competition assays with known chemokine receptors

    • Assess whether binding alters chemokine-mediated cell migration in transwell assays

  • Generation of gG deletion mutants:

    • Create recombinant EHV4 lacking gG expression using BAC mutagenesis

    • Compare replication kinetics in vitro between wild-type and ΔgG viruses

    • Assess pathogenesis in appropriate animal models

    • Evaluate immune cell infiltration at sites of infection

  • Analysis of immune responses:

    • Compare cytokine and chemokine profiles during infection with wild-type versus ΔgG viruses

    • Assess NK cell, neutrophil, and T cell recruitment and activation

    • Measure antibody responses to various viral antigens

    • Evaluate protective immunity following challenge

  • Signaling pathway analysis:

    • Determine whether recombinant gG alters intracellular signaling in immune cells

    • Assess activation of key transcription factors (NF-κB, STAT proteins)

    • Examine expression of immune response genes in the presence/absence of gG

These experimental approaches would provide comprehensive insights into potential immune evasion functions of EHV4 gG, comparable to the established roles of gG homologs in other alphaherpesviruses.

How can recombinant EHV4 gG be utilized to study the epidemiology of EHV4 infections?

Recombinant EHV4 gG offers powerful applications for epidemiological studies of EHV4 infections:

  • Development of type-specific serological assays:

    • ELISA tests using recombinant gG can differentiate between EHV4 and EHV1 antibodies

    • This distinction allows for accurate assessment of EHV4 prevalence in equine populations

    • Longitudinal studies using gG-based diagnostics can track infection patterns over time

  • Retrospective analysis of historical samples:

    • Testing archived sera with gG-based assays can reveal historical infection patterns

    • Evidence for the existence of EHV1 in Australia 10 years prior to the first confirmed abortion case was identified through such approaches

    • Similar methodologies could clarify the historical distribution of EHV4

  • Investigation of risk factors:

    • Type-specific serological testing enables correlation of EHV4 infection with:

      • Age, breed, and geographic distribution

      • Management practices and housing conditions

      • Seasonal variations and climatic factors

      • Co-infections with other pathogens

  • Outbreak investigation:

    • Rapid discrimination between EHV4 and EHV1 in respiratory disease outbreaks

    • Assessment of herd immunity status through pre- and post-outbreak serological profiles

    • Determination of subclinical infection rates through systematic surveillance

These applications highlight how recombinant EHV4 gG serves as a crucial tool for understanding the epidemiology of EHV4 infections, with important implications for disease control strategies in equine populations .

What experimental designs can evaluate the efficacy of recombinant EHV4 gG as a subunit vaccine candidate?

Evaluating recombinant EHV4 gG as a potential subunit vaccine candidate requires rigorous experimental designs:

  • Immunogenicity studies in laboratory animals:

    • Immunize mice or guinea pigs with purified recombinant gG using various adjuvants

    • Compare different doses, formulations, and immunization schedules

    • Assess antibody titers, isotype distribution, and neutralizing capacity

    • Evaluate T cell responses through proliferation assays and cytokine profiling

  • Horse vaccination trials:

    • Design: Randomized, blinded, controlled study with adequate sample size

    • Treatment groups:

      GroupTreatmentAdjuvantNumber of Animals
      1rEHV4 gGAluminum hydroxide10
      2rEHV4 gGISCOM Matrix10
      3ControlAdjuvant only10
    • Vaccination protocol: Primary immunization with two boosters at 3-week intervals

    • Sample collection: Serum and nasal secretions at days 0, 21, 42, and 63

    • Immunological assessment: ELISA titers, virus neutralization, mucosal antibodies

  • Challenge studies:

    • Challenge with virulent EHV4 strain 21 days after final vaccination

    • Clinical parameters: Body temperature, nasal discharge, respiratory rate

    • Virological assessment: Virus shedding (duration and titer) by qPCR and virus isolation

    • Immunological monitoring: Anamnestic antibody response, cellular immunity

  • Data analysis:

    • Statistical comparison of clinical scores between groups

    • Quantitative assessment of virus shedding

    • Correlation between immune responses and protection

    • Safety assessment including local and systemic adverse reactions

This comprehensive approach would determine whether recombinant EHV4 gG can induce protective immunity against EHV4 infection, potentially leading to improved vaccine strategies for this important equine pathogen.

What are the most effective strategies for resolving protein solubility issues when expressing recombinant EHV4 gG?

Researchers working with recombinant EHV4 gG frequently encounter protein solubility challenges. Several effective strategies can address these issues:

  • Expression system optimization:

    • Compare prokaryotic (E. coli) vs. eukaryotic expression systems (insect cells, mammalian cells)

    • For E. coli expression, evaluate specialized strains designed for membrane proteins (C41, C43)

    • Consider cell-free expression systems for problematic constructs

  • Construct design modifications:

    • Express only the extracellular domain (amino acids 36-280) to remove transmembrane regions

    • Focus on the type-specific epitope region (amino acids 287-382)

    • Create fusion proteins with solubility-enhancing partners:

      Fusion PartnerSize (kDa)Purification TagCleavage Method
      GST26GlutathioneFactor Xa
      MBP42AmyloseTEV/Thrombin
      SUMO11His-tagSUMO protease
      Thioredoxin12His-tagEnterokinase
  • Expression condition optimization:

    • Reduce induction temperature (16-20°C)

    • Lower IPTG concentration (0.1-0.5 mM)

    • Add chemical chaperones to growth media (glycerol, sucrose, arginine)

    • Include solubility enhancers in lysis buffers (detergents, high salt)

  • Refolding strategies for inclusion bodies:

    • Solubilize inclusion bodies in denaturing agents (8M urea or 6M guanidine-HCl)

    • Remove denaturant by dialysis or dilution

    • Include redox couples (GSH/GSSG) to facilitate disulfide bond formation

    • Add molecular chaperones to assist refolding

These approaches have successfully addressed solubility issues with various herpesvirus glycoproteins and can be adapted for EHV4 gG expression .

How can researchers overcome challenges in differentiating between antibody responses to EHV4 gG versus cross-reactive antibodies to EHV1 gG?

Differentiating between antibody responses to EHV4 gG and cross-reactive antibodies to EHV1 gG presents significant challenges. Researchers can implement several strategies to address this issue:

  • Peptide-based approaches:

    • Design synthetic peptides representing unique epitopes in the variable regions

    • Create peptide arrays covering the entire gG sequence of both viruses

    • Identify peptides showing strictly type-specific reactions

    • Develop assays based on these discriminatory peptides

  • Competitive binding assays:

    • Pre-incubate test sera with heterologous recombinant protein (e.g., EHV1 gG for EHV4 testing)

    • Remove cross-reactive antibodies through absorption with heterologous antigen

    • Measure residual binding to homologous antigen

    • Calculate inhibition percentages to quantify cross-reactivity

  • Advanced serological techniques:

    • Multiplex assays simultaneously measuring reactivity to both antigens

    • Dual-labeled immunofluorescence assays

    • Antibody avidity measurements to identify primary versus secondary responses

    • Epitope-blocking assays using type-specific monoclonal antibodies

  • Data analysis approaches:

    • Receiver Operating Characteristic (ROC) curve analysis to optimize cut-off values

    • Calculation of reactivity ratios between homologous and heterologous antigens

    • Bayesian statistical models incorporating prior probabilities of infection

    • Machine learning algorithms trained on well-characterized sera panels

Implementation of these approaches has enabled researchers to develop single-well diagnostic assays that can effectively distinguish between horses infected with EHV4, EHV1, or both viruses, overcoming the longstanding challenge of serological cross-reactivity .

How might structural studies of EHV4 gG inform the development of targeted antivirals and improved diagnostics?

Structural studies of EHV4 gG represent a frontier in research with significant implications for antiviral development and diagnostic innovation:

  • Structural determination approaches:

    • X-ray crystallography of recombinant gG or key fragments

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for dynamic regions and ligand interactions

    • Computational modeling informed by homology to known structures

  • Applications for antiviral development:

    • Identification of functional domains critical for gG activity

    • Structure-based design of small molecule inhibitors targeting key protein interactions

    • Development of peptide mimetics that interfere with gG-chemokine interactions

    • Rational design of broadly reactive inhibitors targeting conserved structural elements

  • Implications for diagnostic advancement:

    • Precise mapping of type-specific epitopes at atomic resolution

    • Design of synthetic antigens with enhanced specificity and stability

    • Development of structure-guided antibody engineering for diagnostic reagents

    • Multiplex assay design based on structural distinctions between viral glycoproteins

  • Comparative structural analysis:

    • Alignment with structures of gG from related herpesviruses

    • Identification of conserved structural features versus type-specific elements

    • Evolutionary analysis of structural constraints and variability

    • Integration of structure with functional data to inform biological significance

Recent structural studies of EHV glycoprotein D (gD) have demonstrated the value of this approach, revealing a common V-set immunoglobulin-like core comparable to other gD homologs and identifying key residues (F213 and D261) critical for virus binding and cellular entry . Similar studies with gG would enhance our understanding of its biological functions and applications.

What are the potential applications of CRISPR/Cas9 genome editing in studying EHV4 gG function?

CRISPR/Cas9 genome editing offers revolutionary approaches to study EHV4 gG function:

  • Viral genome modifications:

    • Generation of gG deletion mutants with precise boundaries

    • Introduction of point mutations to assess functional domains

    • Creation of reporter-tagged gG to track expression and localization

    • Engineering of chimeric gG proteins between EHV1 and EHV4

  • Host cell engineering:

    • Knockout of putative gG interaction partners in equine cells

    • Modification of equine chemokine genes to resist gG binding

    • Creation of reporter cell lines for monitoring gG-mediated effects

    • Introduction of human orthologs to assess species specificity

  • Experimental applications:

    • High-throughput screening of gG functions using CRISPR libraries

    • In vivo editing in appropriate animal models

    • Combinatorial modifications of multiple viral glycoproteins

    • Temporal control of gG expression using inducible CRISPR systems

  • Potential research questions addressable with CRISPR:

    • Is gG essential for EHV4 replication in vitro or in vivo?

    • Which domains are critical for type-specificity versus function?

    • Does gG interact with specific host chemokine networks?

    • How does gG contribute to immune evasion and pathogenesis?

CRISPR/Cas9 approaches would complement traditional methodologies like BAC mutagenesis, offering greater precision, efficiency, and versatility for dissecting the complex biology of EHV4 gG and its contributions to viral pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.