Recombinant Equine herpesvirus 4 Envelope protein UL45 homolog (15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we prioritize fulfilling requests for specific tag types if provided in advance.
Synonyms
15; Envelope protein UL45 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)
Target Names
15
Target Protein Sequence
MSGDPTASLKDYQLLELDTAAGNDQAPQLPTKTVLGFTPPLPTLPQPTELVYTKRRRPKR RSRCRCLCFTMGMFAMGVLMTTTLLVSTFVLTVPMVALRTAPCPAQTFGLGDECVRPVSL DAYNSSNSSEIGAVCGAYSEMPAPDNTTVLIMNLLDCLNIGINESAGEKLNLTDTPLANC NFSQNSVCSRKRVGVCYAARPLSPLGELIYKARQALRLDHILPFLQ
Uniprot No.

Target Background

Protein Families
Herpesviridae HHV-1 UL45 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the basic structure and localization of the EHV-4 UL45 homolog protein?

The UL45 homolog in EHV-4 is an envelope protein encoded by ORF15. Based on comparative studies with EHV-1 UL45, which shares significant homology (69% identity) with EHV-4 UL45, it likely functions as a type II membrane glycoprotein . The protein contains a large internal hydrophobic domain that serves as a potential transmembrane region . Immunofluorescence studies with EHV-1 UL45 show that the protein localizes primarily in the cytoplasm, associating with cell membranes in infected cells . The molecular weight of EHV-4 UL45 homolog protein is estimated to be between 30-60 kDa based on western blotting experiments of the related EHV-1 protein .

How does the amino acid sequence of EHV-4 UL45 homolog differ from its counterparts in other herpesviruses?

The EHV-4 UL45 homolog shows moderate amino acid sequence homology to UL45 proteins in other herpesviruses, including herpes simplex virus (HSV), pseudorabies virus (PrV), and bovine herpesvirus 1 (BHV-1) . While sequence homology is moderate, all these proteins share a characteristic large internal hydrophobic domain . Notably, ORF15 of EHV-1 corresponds in position to HSV-1 UL45 but exhibits no significant homology at the amino acid level according to sequence analyses . This suggests evolutionary divergence of function while maintaining structural similarities. Some herpesviruses like varicella-zoster virus (VZV) lack UL45 homologous ORFs entirely .

What are the optimal methods for expressing recombinant EHV-4 UL45 homolog protein for research purposes?

Based on established protocols for similar herpesvirus proteins, recombinant EHV-4 UL45 homolog can be expressed using several systems:

Expression SystemAdvantagesConsiderationsTypical Purity
E. coliCost-effective, high yieldMay lack post-translational modifications≥85% by SDS-PAGE
YeastBetter folding, some glycosylationModerate yield, different glycosylation pattern≥85% by SDS-PAGE
BaculovirusNear-native glycosylationMore expensive, longer production time≥85% by SDS-PAGE
Mammalian cellsNative-like post-translational modificationsHigher cost, lower yield≥85% by SDS-PAGE
Cell-free expressionRapid, avoids cell toxicity issuesLimited post-translational modifications≥85% by SDS-PAGE

For functional studies requiring native conformation and glycosylation patterns, mammalian or baculovirus expression systems are recommended. For structural studies or antibody production, E. coli expression may be sufficient .

What are the recommended methods for detecting EHV-4 UL45 protein in infected cells and tissues?

Several detection methods have proven effective for UL45 homologs in herpesviruses:

  • Western blotting: Using antibodies raised against the N-terminal or C-terminal portions of the protein. For EHV-1 UL45, antisera generated against the carboxyl-terminal 114 amino acids successfully detected specific proteins of varying molecular weights in infected cells .

  • Immunofluorescence assay: Useful for determining subcellular localization. Studies with EHV-1 showed that UL45 protein localizes mainly in the cytoplasm associating with cell membranes .

  • Indirect Immunoperoxidase Test (IIPT): Effective for detecting viral antigens in tissue sections. Protocol typically involves treatment with H₂O₂ solution in methanol, followed by trypsin and calcium chloride solution treatment, then incubation with primary antibodies (e.g., 1:200 dilution of hyperimmune serum), followed by appropriate conjugates .

  • Real-time PCR: For detecting viral gene expression at the mRNA level. Both nasopharyngeal swabs and EDTA blood samples can be used for detection of viral genetic material .

What is the role of UL45 homolog in EHV-4 replication and pathogenesis?

The function of the EHV-4 UL45 homolog is not fully characterized, but insights can be drawn from studies of its EHV-1 counterpart. The EHV-1 UL45 protein is classified as a late (γ-2) protein in the viral replication cycle . Deletion studies of the UL45 gene in EHV-1 strains demonstrated that:

  • UL45 is nonessential for virus growth in vitro but affects replication efficiency .

  • Deletion mutants show a marked reduction in virus release .

  • The protein does not significantly influence plaque size or syncytial phenotype in certain strains (e.g., EHV-1 strain RacH) .

By comparison, UL45-negative mutants of HSV-1 form smaller plaques than wild-type viruses and show altered plaque morphology . This suggests that while nonessential, UL45 may optimize viral replication and spread in both viruses, though with virus-specific effects.

Comparative Analysis and Evolution

The presence of UL45 homologs in some herpesviruses (EHV-1, EHV-4, HSV-1, HSV-2, PrV) but their absence in others (VZV, BHV-1) suggests interesting evolutionary dynamics . This pattern indicates that:

  • UL45 likely performed a function in an ancestral herpesvirus that has been maintained in some lineages.

  • The function became dispensable in certain evolutionary branches, leading to gene loss.

  • Where retained, UL45 may have evolved new or modified functions specific to the viral species.

The moderate amino acid homology despite positional conservation suggests ongoing evolutionary pressure that maintains the general structure while allowing sequence divergence. This makes UL45 an interesting target for studying herpesvirus evolution and host adaptation mechanisms.

What are the implications of UL45 protein variation for vaccine development against EHV-4?

Understanding UL45 homolog variation has significant implications for EHV-4 vaccine development:

  • Antigen conservation: Analysis of UL45 sequence variation across EHV-4 strains would help determine if this protein is a suitable vaccine antigen. Given the moderate sequence conservation among herpesvirus UL45 homologs, strain-specific variation should be assessed.

  • Attenuated vaccine design: Knowledge from EHV-1 studies suggests that UL45 deletion mutants have reduced replication efficiency but remain viable . This property could potentially be exploited in the development of attenuated live vaccines, similar to the approach used with multiple gene deletion mutants of EHV-1 that have shown protective efficacy against wild virus challenge in murine models .

  • Immune response targeting: As a viral envelope protein, UL45 may be a target for neutralizing antibodies. Understanding its expression dynamics and immunogenicity could inform vaccine design strategies.

Current modified live virus (MLV) vaccines for EHV, derived from attenuated strains like EHV-1 RacH, provide incomplete protection against infection . Research into the contribution of UL45 to protective immunity could potentially lead to improved vaccine candidates.

What advanced techniques can be used to study the interaction of UL45 with host cell proteins and other viral proteins?

Several sophisticated techniques can elucidate UL45 interactions with cellular and viral proteins:

  • Proximity-dependent biotin identification (BioID): Fusing UL45 to a biotin ligase to identify proteins in close proximity during infection.

  • Virus-host protein-protein interaction screens: Using techniques such as:

    • Yeast two-hybrid screening with UL45 as bait

    • Co-immunoprecipitation followed by mass spectrometry

    • CRISPR-Cas9 screens to identify host factors affecting UL45 function

  • Live-cell imaging: Creating fluorescently tagged UL45 (similar to the UL45-GFP fusion approach used for EHV-1 ) to track its trafficking and interactions in real-time during infection.

  • Cryo-electron microscopy: To visualize UL45 incorporation into virions and determine its structural arrangement in the viral envelope.

  • Interactome analysis: Computational prediction of potential interaction partners based on structural modeling and validated through targeted biochemical assays.

These approaches would help define the UL45 interactome and uncover its role in the viral replication cycle, potentially identifying new targets for antiviral intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.