Recombinant Equine herpesvirus 4 Envelope protein US9 homolog (76)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
76; Envelope protein US9 homolog; Envelope protein 76; ORF76 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)
Target Names
76
Target Protein Sequence
MGEPEPVVALTEDAPLSVYNPNYRSDNALIADGDSSPIGGDCCPAEAVAAAEEVATAALA SEEIYEMHIKSCISSTTCGDHNNSIGVTSGLTVRAAECHPPSPEAVGIEDVVVVQTAATT NGPSDTVPASAAASVISDDNGCVPLLGSRLELENYDLESGCYYSESDNETASLFIQRVGR RQARRHRRRRVALTVAGVVLVAVLCAISGIVGAFLARVFQ
Uniprot No.

Target Background

Function

Essential for the anterograde spread of infection throughout the host nervous system. In conjunction with the gE/gI heterodimer, US9 plays a crucial role in the sorting and axonal transport of viral structural components to axon terminals.

Protein Families
Alphaherpesvirinae envelope protein US9 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein. Host smooth endoplasmic reticulum membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein. Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein.

Q&A

How does the structure and function of EHV-4 US9 compare to other alphaherpesvirus US9 homologs?

Comparative analysis of US9 proteins across alphaherpesviruses reveals important structural and functional similarities and differences:

VirusMembrane TopologySubcellular LocalizationFunctional Replacement of PRV US9Key Structural Features
EHV-4Type IItrans-Golgi networkNot testedContains conserved endocytic motifs
EHV-1Type IItrans-Golgi networkComplete compensationContains conserved tyrosine and serine residues
PRVType IItrans-Golgi networkNative proteinContains acidic domain with phosphorylation sites
HSV-1Type IItrans-Golgi networkUnable to compensateOriginally mischaracterized as tegument protein
VZVType IItrans-Golgi networkUnable to compensateContains conserved domains
BHV-1Type IItrans-Golgi networkComplete compensationSimilar structural organization to EHV-1 US9

A significant finding is that while all US9 homologs share a similar type II membrane topology and trans-Golgi localization, only the veterinary pathogens EHV-1 and BHV-1 US9 proteins could functionally replace PRV US9 in neuron-to-cell spread assays. The human alphaherpesvirus homologs (HSV-1 and VZV) were unable to compensate for the loss of PRV US9 despite containing all conserved domains .

This functional divergence among structurally similar proteins suggests species-specific interactions with host cellular machinery that may reflect evolutionary adaptation to different hosts.

For Localization and Topology Studies:

  • Fluorescent Protein Fusions: Enhanced green fluorescent protein (EGFP) fusions to the C-terminus of US9 have been successfully used to examine subcellular localization and membrane topology .

  • Co-localization Studies: Using markers like GalT-mRFP1 (trans-Golgi network marker) to confirm specific organelle localization.

  • Membrane Topology Analysis: Surface immunolabeling techniques to determine protein orientation in cellular membranes.

For Functional Studies:

  • Compartmented Chamber Systems: These allow for the study of anterograde, neuron-to-cell spread of infection, particularly useful for examining US9's role in axonal transport .

  • Recombinant Virus Construction: Using BAC (Bacterial Artificial Chromosome) systems and CRISPR/Cas9-mediated homologous recombination for generating US9 mutants or deletions .

  • Primary Neuronal Cultures: Essential for studying the neurotropic aspects of US9 function in a physiologically relevant context.

For Molecular Characterization:

  • PCR and Cloning: Using primers designed to amplify the US9 ORF with appropriate restriction enzyme sites (e.g., EcoRI and BamHI linkers) .

  • Western Blot Analysis: For detecting expression and post-translational modifications, though cross-reactivity between US9 homologs is minimal .

  • RT-PCR: For confirming gene expression when antibodies are unavailable.

Each methodology should be selected based on the specific research question being addressed, with consideration for the limitations of each approach in the context of EHV-4 biology.

How can researchers effectively generate and characterize US9-deleted or modified EHV-4 mutants?

Creating US9-deleted or modified EHV-4 mutants requires careful experimental design and involves several advanced molecular techniques:

Step-by-Step Methodology:

  • BAC Clone Construction:

    • The EHV-4 genome can be cloned into a bacterial artificial chromosome (BAC) vector.

    • This process has been successfully applied to related herpesviruses like EHV-1 .

  • CRISPR/Cas9-Mediated Mutagenesis:

    • This cutting-edge approach significantly enhances homologous recombination efficiency (up to 86% in PRV) .

    • Design sgRNAs targeting sequences near US9 (ORF76) in the EHV-4 genome.

    • Create a donor plasmid containing homology arms flanking the desired modification.

  • Key Considerations for sgRNA Design:

    • Position the sgRNA cutting sites near but not within the homology arms.

    • Double incisions promote higher recombination efficiency than single incisions.

    • The optimal distance between two incision sites correlates with recombination efficiency .

  • Verification Methods:

    • PCR and sequencing to confirm the mutation.

    • Restriction enzyme digestion patterns to verify genome integrity.

    • Western blot analysis using antibodies against US9.

    • RT-PCR to confirm gene expression/deletion at the RNA level.

  • Functional Characterization:

    • Growth kinetics in various cell types (e.g., equine dermal cells, rabbit kidney cells).

    • Plaque size and morphology analysis.

    • Neuron-to-cell spread assays in compartmented chamber systems.

    • In vivo pathogenesis studies in appropriate animal models.

This approach has been validated with related alphaherpesviruses where "Ab4pΔORF76 (US9 deletion) and its revertant BACs were sequentially constructed, with the correct replacement and genotypes confirmed by PCR, sequencing, and BamHI digestion patterns" .

What is the role of EHV-4 US9 in axonal transport of viral components?

Based on homology with other alphaherpesvirus US9 proteins, EHV-4 US9 likely plays a critical role in axonal transport mechanisms:

Mechanism of Action:

  • Sorting Signal Function: US9 acts as a targeting signal for viral structural components into the axon of infected neurons.

  • Trans-Golgi Network Localization: EHV-4 US9, like other homologs, predominantly localizes to the trans-Golgi network (TGN) , positioning it to function in the sorting of newly synthesized viral proteins.

  • Microdomain Association: US9 proteins are enriched in lipid raft microdomains, which may facilitate their function in protein sorting and trafficking .

  • Tyrosine and Serine Residues: Critical tyrosine and serine residues within the acidic domain are likely essential for US9 function, as demonstrated in PRV where:

    • Mutation of conserved tyrosines to alanines abrogates anterograde sorting

    • Modification of serine residues (casein kinase II phosphorylation sites) affects the rate of axonal sorting

  • Directionality Control: US9 specifically facilitates anterograde transport (from cell body to axon terminals) but not retrograde transport.

Experimental Evidence from Related Viruses:

The mechanistic differences between US9 homologs may partially explain the distinct neurotropism and pathogenic potential of EHV-4 compared to other alphaherpesviruses.

What evidence exists for recombination involving the US9 gene in field isolates of EHV-4?

Research has revealed significant differences in recombination patterns between EHV-4 and EHV-1, with important implications for US9 evolution:

Recombination Analysis Findings:

  • Widespread Recombination in EHV-4: High-throughput sequencing and recombination detection methods have provided "evidence of widespread recombination in the genomes of the EHV-4 isolates" .

  • Regional Distribution of Recombination: Recombination events in EHV-4 occur throughout the genome, including:

    • UL region (detected by Phi test)

    • US region (containing US9/ORF76)

    • IR regions

  • Limited Recombination in EHV-1: In contrast, "only one potential recombination event was detected in the genomes of the EHV-1 isolates, even when the genomes from an additional 11 international EHV-1 isolates were analysed" .

  • Methodological Consistency: Multiple recombination detection methods within RDP4 software consistently identified numerous recombination events in EHV-4 but not in EHV-1 .

Epidemiological Factors:

The striking difference in recombination frequency may be related to epidemiological differences between the viruses. EHV-4 shows nearly universal seroprevalence in some horse populations (>99% in certain studies), suggesting frequent reactivation and opportunities for co-infection and recombination .

This high rate of natural recombination in EHV-4 has significant implications for:

  • Viral evolution and adaptation

  • Vaccine development strategies

  • Diagnostic test reliability

  • Emergence of novel pathogenic variants

Researchers studying US9 must consider these recombination patterns when interpreting sequence data from field isolates and when designing experiments to examine US9 function in natural EHV-4 populations.

Immune Evasion Strategies:

  • MHC-I Downregulation: Some alphaherpesvirus proteins cooperate to downregulate MHC class I surface expression. For example, in EHV-1:

    • pUL56 (unrelated to US9) enhances internalization of MHC-I through dynamin-dependent endocytosis

    • pUL43 partners with pUL56 to mediate MHC-I downregulation

  • Type-Specific Antigenicity: EHV-4 glycoprotein G (gG), which is encoded in the US region near US9, functions as a type-specific antigen. It "reacted with monospecific sera from horses that had been immunized or infected with EHV4, but not with monospecific sera from horses immunized or infected with EHV1" .

  • Potential Secreted Form: Some US9 homologs may have secreted forms that could interact with immune components, as suggested by the identification of EHV-4 glycoproteins in the supernatant of infected cell cultures .

Implications for Research and Diagnostics:

  • The type specificity of proteins in the US region makes them valuable targets for differential diagnosis between EHV-4 and the closely related EHV-1.

  • Researchers should consider potential immune evasion functions when studying US9, particularly in the context of viral persistence and reactivation.

  • The development of recombinant US9 for experimental use should account for potential immunomodulatory functions that might be missed in simple expression systems.

What are the challenges in developing antibodies specific to EHV-4 US9?

Developing specific antibodies against EHV-4 US9 presents several technical challenges that researchers must overcome:

Fundamental Challenges:

  • Limited Cross-Reactivity: Studies have shown "no cross-reactivity of the various Us9 antisera with nonconjugate Us9 homologs, consistent with the high similarity between Us9 domains and minimal primary amino acid identity" . This means:

    • Each Us9 homolog requires specific antibody development

    • Antibodies against related viruses (like EHV-1 US9) cannot be reliably used

  • Protein Abundance Issues: Previous studies with HSV-1 US9 noted challenges with "low abundance of the antigen and weak nature of the antipeptide serum" , suggesting similar issues might occur with EHV-4 US9.

  • Membrane Protein Complications: As a type II membrane protein, US9 has limited exposed epitopes, complicating antibody generation.

Methodological Approaches:

  • Recombinant Protein Strategy:

    • Express the full extracellular domain (N-terminal region) as a recombinant protein

    • Use suitable tags (e.g., His-tag) for purification while ensuring they don't interfere with epitope presentation

    • Proper folding may require eukaryotic expression systems rather than bacterial systems

  • Synthetic Peptide Approach:

    • Design multiple peptides representing predicted antigenic regions

    • Conjugate to carrier proteins like KLH or BSA

    • Implement comprehensive screening to identify the most specific antibodies

  • Validation Requirements:

    • Western blot analysis against infected cell lysates

    • Immunofluorescence to confirm expected subcellular localization

    • Negative controls using US9-deleted virus mutants

    • Cross-reactivity testing against other alphaherpesvirus US9 proteins

Researchers should consider using multiple methodologies for detection when studying US9, including genetic approaches (RT-PCR) as demonstrated in studies where "expression was confirmed by RT-PCR on mRNA harvested from PK15 cells" when antibodies were unavailable.

How can researchers use comparative genomics to better understand EHV-4 US9 evolution?

Comparative genomic approaches provide valuable insights into the evolution and function of EHV-4 US9:

Analytical Frameworks:

  • Whole Genome Sequencing and Comparison:

    • High-throughput sequencing of EHV-4 isolates from different geographical regions and outbreaks

    • Comparative analysis with related alphaherpesviruses (EHV-1, HSV-1, VZV, PRV, BHV-1)

    • Focus on US region architecture across viral species

  • Molecular Phylogenetic Analysis:

    • Construction of phylogenetic trees based on US9 sequences

    • Analysis of selection pressures using dN/dS ratios

    • Identification of conserved vs. variable regions

  • Structural Prediction and Comparison:

    • Prediction of protein secondary and tertiary structures

    • Identification of functional domains through structural homology

    • Analysis of membrane topology and interaction surfaces

Research Findings and Applications:

Comparative genomic studies have revealed that despite high functional conservation, US9 homologs show significant sequence divergence. The US region of EHV-4 contains distinctive features:

  • Sequence Conservation Patterns: "Four open reading frames (ORFs) were identified of which ORF4 showed 52% similarity to the gene-encoding PRV gX in a 650-nucleotide region" .

  • Genomic Architecture: In some EHV-1 strains like KyA, "genes US6 (ORF73; gI), US7 (ORF74; gE), and US8 (ORF75; 10 K) were deleted as compared to the sequences of Ab4 and RacL11" , suggesting evolutionary flexibility in the US region.

  • Recombination Hotspots: Evidence of recombination in the US region of EHV-4 but not EHV-1 suggests different evolutionary pressures and mechanisms .

These findings can guide functional studies by identifying:

  • Conserved motifs likely essential for basic functions

  • Variable regions that may contribute to host/tissue specificity

  • Potential interaction domains based on co-evolution patterns with other viral or host proteins

What experimental systems are optimal for studying the function of EHV-4 US9 in neuronal transport?

Investigating the neuronal transport functions of EHV-4 US9 requires specialized experimental systems:

In Vitro Neuronal Models:

  • Primary Equine Neuronal Cultures:

    • Most physiologically relevant but technically challenging

    • Requires fresh equine neural tissue from specific ganglia

    • Limited availability and ethical considerations

  • Primary Rodent Neuronal Cultures:

    • More accessible alternative

    • Evidence that "the growth kinetics of Ab4p∆ORF76 in primary cultured mouse neurons were similar to those of Ab4pΔORF76R and Ab4p attB"

    • Allows for genetic manipulation (knockout mice)

  • Compartmentalized Chamber Systems:

    • Critical for studying directional transport

    • Physical separation of neuronal cell bodies from axon terminals

    • Enables specific analysis of anterograde vs. retrograde transport

    • Successfully used for studying US9 homologs: "we examined whether any of the Us9 homologs could compensate for the loss of PRV Us9 in anterograde, neuron-to-cell spread of infection in a compartmented chamber system"

Advanced Imaging Technologies:

  • Live-Cell Imaging:

    • Real-time visualization of US9-EGFP fusion protein trafficking

    • Quantification of transport dynamics (velocity, directionality)

    • Colocalization with cellular transport machinery

  • Super-Resolution Microscopy:

    • Nanoscale resolution of US9 localization in axonal structures

    • Visualization of interactions with microtubule transport systems

    • Enhanced detection of small transport vesicles

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines fluorescence tracking with ultrastructural analysis

    • Identifies precise subcellular compartments containing US9

    • Visualization of virion components during axonal transport

Key Experimental Considerations:

  • Time Course Analysis: "Expression of pUL43 was detectable from 2 h postinfection (p.i.) but decreased after 8 h p.i. due to lysosomal degradation" - similar temporal dynamics may apply to US9

  • Cell Type Validation: Test multiple neuronal types as "infectious progeny yield and time course of Ab4p∆ORF76 were almost the same as those of Ab4p attB and Ab4p∆ORF76R in MDBK cells, RK13 cells and FHK cells"

  • Complementation Studies: Assess functional conservation through cross-species complementation as "EHV-1 and BHV-1 Us9 were able to fully compensate for the loss of PRV Us9, whereas VZV and HSV-1 Us9 proteins were unable to functionally replace PRV Us9"

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.