Recombinant Erinaceus europaeus Alpha-2B adrenergic receptor (ADRA2B)

What is the basic structure of Erinaceus europaeus ADRA2B protein?

Erinaceus europaeus Alpha-2B adrenergic receptor (ADRA2B) is a 391-amino acid protein that functions as an adrenergic receptor. The full protein sequence includes regions that form transmembrane domains typical of G-protein-coupled receptors (GPCRs). The amino acid sequence features characteristic motifs including "AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYL RIYLIAKRSHCRGPRAKGAPGKGESKQTGQASLGAPSSAKLPNLVSRLVAAREANRHSKS TGEKVEGETPEGPGTPGVPPSWPPLPSSGRGQEEDIYRASPEEEAGDDEEEECEPQAVPV SPASACSPPLQQPQGSRVLATLRGQVLLSRGVGTASGQWWRRRAQLTREKRFTFVLAVVI GVFVLCWFPFFFSYSLGAICPQHCKVPHGLF" . The computed structure model available in protein databases has a global pLDDT (predicted Local Distance Difference Test) score of 68.44, indicating moderate confidence in the structural prediction .

How does recombinant Erinaceus europaeus ADRA2B differ from human ADRA2B?

While both proteins function as alpha-2B adrenergic receptors, they exhibit species-specific differences in amino acid sequence that may affect binding properties and downstream signaling. The Erinaceus europaeus (Western European hedgehog) variant represents an evolutionarily distinct form that researchers use as a comparative model to human ADRA2B. Sequence alignment and structural analysis reveal conserved functional domains between species but with specific variations that can provide insights into receptor evolution and structure-function relationships. Using recombinant hedgehog ADRA2B allows researchers to investigate conserved noradrenergic signaling mechanisms while highlighting species-specific adaptations .

What are the standard expression systems for producing recombinant ADRA2B?

Recombinant Erinaceus europaeus ADRA2B protein is typically expressed in prokaryotic systems, with E. coli being the most common expression host. The recombinant protein is often produced with an N-terminal His-tag to facilitate purification through affinity chromatography . While E. coli provides high yields of protein, researchers should be aware that this prokaryotic expression system lacks post-translational modification capabilities that might be present in the native protein. For functional studies requiring properly folded and modified protein, alternative expression systems such as insect cells (Sf9, Sf21) or mammalian cells (HEK293, CHO) may be preferable, though these are more complex and typically produce lower yields than bacterial systems .

What are the optimal storage and reconstitution conditions for recombinant ADRA2B?

Recombinant ADRA2B protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt. For long-term storage, aliquoting is necessary to avoid repeated freeze-thaw cycles which can compromise protein integrity. For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being standard) helps maintain stability during storage. After reconstitution, working aliquots can be stored at 4°C for up to one week, but longer storage requires freezing at -20°C or -80°C . When handling the protein, centrifuging the vial briefly before opening is recommended to bring contents to the bottom of the tube.

What experimental applications are suitable for recombinant ADRA2B protein?

Recombinant ADRA2B protein can be utilized in various research applications including:

• Structural studies: X-ray crystallography, cryo-electron microscopy, or NMR analyses to determine receptor conformation and binding sites

• Binding assays: To investigate ligand-receptor interactions with adrenergic agonists and antagonists

• Protein-protein interaction studies: Co-immunoprecipitation and pull-down assays to identify binding partners

• Antibody production: As an immunogen for developing specific antibodies against ADRA2B

• SDS-PAGE analysis: For protein characterization and purity assessment

The high purity (>90% by SDS-PAGE) makes this recombinant protein suitable for in vitro assays, though researchers should validate its functional activity for their specific experimental systems.

How can researchers verify the functional activity of recombinant ADRA2B?

Verifying functional activity of recombinant ADRA2B requires assessing its ability to bind specific ligands and trigger appropriate downstream signaling cascades. Recommended methods include:

• Radioligand binding assays using selective alpha-2 adrenergic ligands (such as [³H]-yohimbine)

• GPCR functional assays measuring inhibition of adenylyl cyclase activity

• GTPγS binding assays to measure G-protein activation

• Calcium flux assays in cellular systems expressing the recombinant receptor

• Phosphorylation status of downstream effectors like ERK1/2

For comparative analysis, parallel testing with the human ADRA2B variant can provide context for species-specific differences in binding affinity and signaling efficiency. Researchers should carefully control for expression levels and cellular background when conducting functional assays.

How does the ADRA2B deletion variant affect emotional memory processing?

The ADRA2B deletion variant (deletion of three glutamic acid residues at positions 301-303) significantly alters emotional memory processing. Research indicates that carriers of this deletion show enhanced activity in the amygdala and inferior frontal gyrus specifically during successful emotional memory formation, but not during memory retrieval . The variant affects how emotional information is encoded into long-term memory, creating a bias toward emotionally salient information. In experimental paradigms, deletion carriers demonstrate superior memory for emotional stimuli compared to neutral stimuli, with pronounced effects during the encoding phase rather than retrieval. This suggests that the variant influences the initial processing and consolidation of emotional information, potentially through modulation of noradrenergic signaling in the amygdala and associated limbic structures .

What are the combined effects of ADRA2B and CB1 deletion variants on affective memory in aging populations?

Studies examining the interaction between ADRA2B and CB1 deletion variants reveal complex effects on affective memory processing in older adults. Double deletion carriers (those carrying both ADRA2B and CB1 variants) demonstrate superior working memory performance, particularly with emotionally valenced material. Notably, these individuals show a distinct "positivity effect," preferentially remembering positive information over negative or neutral content. This contrasts with single deletion carriers who exhibit a more general emotional enhancement effect, remembering both positive and negative stimuli better than neutral stimuli .

This genetic interaction becomes more pronounced with cognitive load—as working memory tasks increase in difficulty (with longer strings of items to remember), the advantage for double deletion carriers becomes more evident. These findings suggest that the combination of these genetic variants may enhance cognitive resource allocation toward emotional (particularly positive) information in aging populations, potentially reflecting compensatory mechanisms or altered motivational priorities in older adults .

How does stress interact with the ADRA2B deletion variant to affect learning and memory?

These findings indicate that ADRA2B deletion variant carriers maintain a sensitized stress response system that amplifies stress effects on cognitive processes. The mechanism likely involves altered norepinephrine availability during emotional events, leading to enhanced amygdala activation and subsequent memory consolidation. This stress sensitivity may explain why the deletion variant has been implicated as a potential susceptibility factor for traumatic memory formation and post-traumatic stress disorder (PTSD)-related phenotypes .

What experimental designs best capture ADRA2B's influence on emotional memory formation?

Optimal experimental designs for investigating ADRA2B's effects on emotional memory should incorporate several key elements:

• Genotyping protocol: Precise genotyping for the ADRA2B deletion variant (deletion of 3 glutamic acid residues at positions 301-303) using PCR-based methods with appropriate controls.

• Emotional memory paradigm: Tasks should include stimuli varying in both valence (positive/negative/neutral) and arousal levels. Examples include:

  • Emotional word lists with controlled linguistic properties

  • Standardized emotional images (e.g., International Affective Picture System)

  • Emotional faces or scenes with varying intensities

• Memory assessment at multiple timepoints:

  • Immediate recall/recognition (encoding)

  • Delayed recall/recognition (24-48 hours later) to assess consolidation

  • Extended follow-up (1+ weeks) for examining long-term retention

• Manipulation of encoding conditions:

  • Stress induction before encoding (using validated protocols like the Socially Evaluated Cold Pressor Test)

  • Timing variations (immediate vs. delayed stress effects)

  • Pharmacological manipulations of noradrenergic system

• Neuroimaging components:

  • fMRI during encoding and retrieval to assess amygdala and prefrontal engagement

  • Event-related potential (ERP) measures to capture temporal dynamics

These designs should control for potential confounding variables including age, sex, stress hormone levels (cortisol), and time of day to account for circadian fluctuations in memory performance and stress reactivity .

What are the challenges in developing functional assays for ADRA2B receptor signaling?

Developing reliable functional assays for ADRA2B signaling presents several technical challenges:

• Membrane receptor expression: As a seven-transmembrane GPCR, ADRA2B requires proper membrane integration and folding for functionality. Expression systems must preserve native conformation and orientation.

• G-protein coupling specificity: ADRA2B couples primarily to Gi/o proteins, inhibiting adenylyl cyclase. Assay systems must contain appropriate G-protein subtypes to recapitulate natural signaling.

• Signal detection sensitivity: The inhibitory nature of alpha-2 adrenergic signaling (decreasing cAMP) makes signal detection more challenging than for receptors that increase measurable second messengers.

• Constitutive activity considerations: Distinguishing between ligand-independent (constitutive) activity and ligand-induced effects requires careful experimental controls.

• Receptor desensitization and trafficking: ADRA2B undergoes desensitization following prolonged agonist exposure, necessitating time-course studies and internalization assessments.

Recommended approaches include:

• BRET/FRET-based assays for measuring G-protein coupling

• Impedance-based cellular assays for real-time, label-free detection

• Multiplex assays capturing different signaling nodes simultaneously

• Reporter gene assays with appropriate response elements

• Phospho-specific antibodies to detect downstream signaling events

Validation should include positive controls (known ADRA2B agonists/antagonists) and negative controls (structurally related but non-binding compounds) .

How can researchers distinguish the molecular effects of different ADRA2B variants in experimental settings?

Distinguishing molecular effects of ADRA2B variants requires multifaceted experimental approaches:

• In vitro expression systems:

  • Stable cell lines expressing different ADRA2B variants under identical promoters

  • Inducible expression systems to control receptor density

  • Native cellular backgrounds vs. receptor-null backgrounds

• Comprehensive signaling profiles:

  • Dose-response curves for canonical and non-canonical pathways

  • Temporal resolution of signaling cascades (early vs. late responses)

  • Biased signaling analysis between G-protein and β-arrestin pathways

• Binding kinetics assessment:

  • Association/dissociation rate constants (kon/koff)

  • Residence time measurements for different ligands

  • Competitive binding assays with subtype-selective compounds

• Structural biology approaches:

  • Hydrogen-deuterium exchange mass spectrometry to identify conformational differences

  • Site-directed mutagenesis to map functional domains

  • Molecular dynamics simulations based on structural models

• Cellular trafficking and regulation:

  • Fluorescently tagged receptors to track localization

  • Pulse-chase experiments to measure receptor turnover rates

  • Proteasomal/lysosomal inhibitors to assess degradation pathways

When comparing the common deletion variant (301-303 glutamic acid deletion) with wild-type ADRA2B, researchers should evaluate differential responses to agonists and antagonists, altered receptor phosphorylation patterns, and changes in protein-protein interaction networks .

How do ADRA2B structural features compare across different species?

The ADRA2B receptor shows notable conservation across mammalian species while maintaining species-specific variations that may influence function. Erinaceus europaeus ADRA2B maintains the fundamental seven-transmembrane domain structure characteristic of G-protein coupled receptors, but sequence analysis reveals species-specific variations particularly in the third intracellular loop and C-terminal domains that may affect G-protein coupling and downstream signaling .

Evolutionary analysis suggests that while the binding pocket for catecholamines remains highly conserved, species-specific adaptations in regulatory domains may reflect different environmental pressures and physiological needs across species. These comparative insights are valuable for understanding the fundamental versus adaptable features of adrenergic signaling systems.

What are the technical considerations for using recombinant ADRA2B in interspecies comparative studies?

When conducting interspecies comparative studies using recombinant ADRA2B proteins, researchers should address several technical considerations:

• Expression system standardization: Using identical expression systems (e.g., E. coli, mammalian cells) for all species variants to minimize system-specific artifacts. The standard E. coli expression system used for Erinaceus europaeus ADRA2B may introduce limitations due to lack of post-translational modifications .

• Tag positioning and interference: The His-tag used in recombinant Erinaceus europaeus ADRA2B could potentially interfere with receptor function differently across species variants. Consider tag removal or consistent tag placement.

• Buffer and reconstitution conditions: Different species variants may exhibit varying stability under standard storage conditions. Optimization of buffer components (pH, salt concentration, additives) may be necessary for each variant .

• Functional assay calibration: Establishing appropriate positive controls for each species to account for intrinsic efficacy differences. Reference compounds with known potency across species should be included.

• Pharmacological profile verification: Complete concentration-response curves should be generated for multiple ligands to detect subtle species differences in potency, efficacy, and selectivity.

• Membrane composition effects: For membrane-integrated assays, lipid composition can significantly impact receptor function and may need to be optimized for each species variant.

These considerations help ensure that observed differences represent true species variations rather than technical artifacts, providing more reliable comparative data for evolutionary and pharmacological analyses.

Table 1: Properties of Recombinant Erinaceus europaeus ADRA2B Protein

Data compiled from product specifications

Table 2: Confidence Metrics for ADRA2B Structural Model

Data derived from AlphaFold database entry AF_AFO19012F1

Table 3: Comparative Effects of ADRA2B Deletion Variant on Memory Processes

Data synthesized from studies on ADRA2B genetic variation

What are the unresolved questions regarding ADRA2B function in neural circuits?

Despite extensive research, several critical gaps remain in our understanding of ADRA2B function in neural circuits:

• Circuit-specific contributions: While ADRA2B is known to influence amygdala and prefrontal cortex activation, the receptor's role in specific neural circuits and cell types remains poorly characterized. Future research using conditional knockout models or cell-type-specific manipulations could elucidate these circuit-specific functions.

• Developmental timing effects: Little is known about how ADRA2B function changes across the lifespan, particularly during critical neurodevelopmental periods versus aging. Longitudinal studies examining ADRA2B genetic effects across development could address this gap.

• Interaction with other neurotransmitter systems: Though primarily studied in isolation, ADRA2B likely functions within complex networks involving multiple neurotransmitter systems. Research examining interactions with serotonergic, dopaminergic, or cholinergic systems would provide a more comprehensive understanding of its neuromodulatory role.

• Species-specific adaptations: Comparative studies across species could reveal whether ADRA2B function has undergone significant evolutionary adaptations or maintained conserved functions across mammals .

These research directions would significantly advance our understanding of ADRA2B's role in emotion, cognition, and stress responsivity.

How might recent technological advances improve recombinant ADRA2B production and analysis?

Recent technological advances offer promising opportunities for improved recombinant ADRA2B production and analysis:

• CRISPR-Cas9 engineered expression systems: Precise genomic integration of ADRA2B at defined loci in mammalian cells could ensure consistent expression levels and reduce positional effects that complicate interpretation.

• Nanobody and aptamer development: Novel ADRA2B-specific binders could enable better detection, purification, and functional modulation without the limitations of traditional antibodies.

• Cryo-EM advances: Improvements in single-particle cryo-electron microscopy now allow structural determination of GPCRs in multiple conformational states, potentially revealing the molecular basis for ADRA2B variant functional differences.

• Microfluidic cell-free expression systems: These systems could enable rapid production and screening of ADRA2B variants without the constraints of cellular expression.

• AI-assisted protein design: Computational approaches using machine learning could predict the effects of specific mutations or design optimized expression constructs with improved stability and yield.

• Biosensor development: FRET/BRET-based sensors that directly report on ADRA2B conformational changes could provide real-time readouts of receptor activation in living cells .

These technological approaches could overcome current limitations in recombinant ADRA2B research and accelerate progress in understanding this receptor's structure-function relationships.