Recombinant Erinaceus europaeus Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Erinaceus europaeus (Western European hedgehog) Gap Junction Alpha-1 Protein (GJA1) is a genetically engineered form of the connexin 43 (Cx43) protein, produced to study gap junction-mediated intercellular communication in biological systems. GJA1 is a critical component of gap junctions, which facilitate the transfer of ions, metabolites, and signaling molecules between adjacent cells . This recombinant protein enables researchers to investigate the structural and functional roles of GJA1 in hedgehog physiology and its evolutionary conservation across species.

Protein Characteristics

  • Gene Name: GJA1 (gap junction protein alpha 1) .

  • UniProt ID: Q6TYA8 (Erinaceus europaeus) .

  • Amino Acid Sequence: Comprises 382 residues, with sequence homology to human and rodent GJA1 (e.g., human UniProt P17302, rat UniProt P08050) . Key domains include four transmembrane helices, two extracellular loops, and cytoplasmic N-/C-termini critical for channel gating and protein interactions .

  • Post-Translational Modifications: Phosphorylation sites (e.g., Ser368) and an RPEL-like actin-binding domain are conserved, suggesting roles in cytoskeletal regulation .

Table 1: Sequence Comparison of GJA1 Orthologs

SpeciesUniProt IDLength (aa)Key Features
Erinaceus europaeusQ6TYA8382RPEL motif, cytoplasmic actin binding
Homo sapiensP17302382Phosphorylation at Ser368
Rattus norvegicusP08050382High homology to hedgehog GJA1

Production and Purification

  • Expression System: Produced in Escherichia coli with N-terminal His-tag or Myc-tag for purification .

  • Purity: >90% as confirmed by SDS-PAGE .

  • Storage: Lyophilized in Tris/PBS buffer with 50% glycerol; stable at -80°C .

Biological Roles

  • Gap Junction Assembly: Forms hexameric connexons that dock with adjacent cells to create ion channels .

  • Ciliogenesis Regulation: Interacts with Rab11/Rab8 trafficking pathways to promote ciliary axoneme formation, as observed in Xenopus and human cell models .

  • Cytoskeletal Dynamics: Stabilizes F-actin filaments and microtubules, aiding intracellular transport of Cx43 to membrane junctions .

Disease Associations

  • Mutations: Linked to craniometaphyseal dysplasia, erythrokeratodermia, and cardiac malformations in humans .

  • Research Applications: Used to study hedgehog-specific GJA1 variants and their pathological mechanisms .

Experimental Use Cases

  • ELISA and Immunoprecipitation: Detects protein-protein interactions (e.g., Rab11 colocalization) .

  • Cilia Formation Assays: Evaluates GJA1’s role in multiciliated cell development .

  • Structural Studies: Resolves conformational changes via cryo-EM (e.g., PDB IDs 7F92, 7Z1T) .

Table 2: Key Applications of Recombinant Hedgehog GJA1

ApplicationMethodOutcome
Protein InteractionCo-IP + Western BlotConfirmed Rab11 binding
Trafficking AnalysisSIM MicroscopyVisualized Rab11 vesicle distribution
Cytoskeletal StudiesActin Co-sedimentationDemonstrated F-actin stabilization

Supplier and Availability

  • Vendor: Creative BioMart (Product ID: CSB-CF750991EMQ) .

  • Formats: Lyophilized powder (50 µg/vial) or liquid aliquots .

  • Applications: SDS-PAGE, antibody production, and in vitro functional assays .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate special format requests. Please specify your requirements when placing the order, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know, and we will prioritize development according to your specification.
Synonyms
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-382
Protein Length
Full Length of Mature Protein
Species
Erinaceus europaeus (Western European hedgehog)
Target Names
Target Protein Sequence
GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGA NVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGIKDRVK GKSDLYHATTGPLSPSKDRGSPTYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDAQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function
Gap junction protein acting as a regulator of bladder capacity. A gap junction is composed of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low molecular weight materials diffuse between adjacent cells. This protein may play a critical role in hearing physiology by participating in potassium recycling to the cochlear endolymph. It is a negative regulator of bladder functional capacity, enhancing intercellular electrical and chemical transmission, thereby sensitizing bladder muscles to cholinergic neural stimuli and triggering contraction. It may also play a role in cell growth inhibition by regulating NOV expression and localization. This protein plays an essential role in gap junction communication within the ventricles.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.

Q&A

What is GJA1 and what cellular functions does it mediate?

GJA1 (gap junction protein, alpha 1, 43kDa) is a member of the connexin gene family that forms essential components of gap junctions—specialized intercellular channels allowing direct communication between adjacent cells. These junctions are composed of arrays of channels that provide routes for the diffusion of low molecular weight materials from cell to cell .

GJA1 exhibits multiple biochemical functions, including:

  • Ion transmembrane transporter activity

  • Gap junction channel activity

  • SH3 domain binding

  • PDZ domain binding

  • Connexin binding

  • Signal transducer activity

In cardiac tissue, GJA1 plays a crucial role in the synchronized contraction of the heart and is essential for proper embryonic development . The protein facilitates both electrical coupling (passage of ions) and metabolic coupling (exchange of small molecules) between cells, forming the molecular basis for coordinated cellular activities in tissues .

How conserved is GJA1 across mammalian species, particularly in Erinaceus europaeus?

Evolutionary analysis reveals GJA1 demonstrates remarkably high conservation across mammalian species, including Erinaceus europaeus (Western European hedgehog). Molecular phylogenetic studies have shown that the GJA1 gene has undergone strong purifying selection during mammalian evolution, with an average dN/dS ratio of approximately 0.024, indicating that synonymous mutation rates significantly exceed non-synonymous mutation rates .

This high conservation suggests the functional importance of GJA1 has remained consistent throughout mammalian evolution. Importantly, the evolutionary patterns of GJA1 closely correspond with species divergence patterns, making it a valuable molecular marker for phylogenetic reconstruction, particularly for investigating high-level relationships in mammals .

The conservation patterns observed in Erinaceus europaeus GJA1 align with those of other mammals in the Laurasiatheria clade, which includes hedgehogs, bats, carnivores, and artiodactyls, all supported as a monophyletic group in phylogenetic analyses .

What is the typical structural organization of recombinant GJA1 protein?

Recombinant GJA1 forms a dodecameric channel structure created by the end-to-end docking of two hexamers. Each hexamer displays 24 rods of density in the membrane interior, which is consistent with an alpha-helical conformation for the four transmembrane domains of each connexin subunit .

The channel structure demonstrates distinct organizational characteristics:

  • Transmembrane regions consist primarily of alpha-helical rods

  • Extracellular domains exhibit a double-layered appearance

  • The extracellular vestibule forms a tight seal that prevents exchange with the extracellular milieu

  • Complete channels are formed when two hexameric hemichannels (connexons) from adjacent cells dock together

For recombinant human GJA1, the protein segment spanning amino acids 233-382 has a molecular mass of approximately 20.3 kDa when expressed with an N-terminal His tag . While specific structural data for Erinaceus europaeus GJA1 is not directly available in the search results, the high conservation across mammals suggests similar structural characteristics.

How do expression systems affect the structural integrity and functional properties of recombinant Erinaceus europaeus GJA1?

Expression systems significantly impact the structural integrity and functional properties of recombinant GJA1 proteins. For optimal experimental outcomes, researchers should consider several system-specific factors:

E. coli expression systems:
E. coli systems, while efficiently producing recombinant GJA1 protein fragments (as seen with human GJA1 amino acids 233-382) , may lack the post-translational modification machinery necessary for full protein functionality. When expressing Erinaceus europaeus GJA1 in E. coli:

  • The cytoplasmic and extracellular domains may be correctly folded, but transmembrane regions might require optimization

  • Denaturation/renaturation protocols may be necessary to achieve proper folding

  • Fusion tags (such as His tags) can be strategically positioned to minimize interference with functional domains

Mammalian expression systems:
For functional studies requiring native conformation and post-translational modifications, mammalian cell lines (particularly those derived from cardiac or neural tissues) may provide superior results for Erinaceus europaeus GJA1:

  • These systems better replicate the natural membrane insertion and oligomerization processes

  • Gap junction plaques formation can be directly visualized and studied

  • Physiological regulation mechanisms are maintained

Insect cell systems:
These provide an intermediate option balancing yield with post-translational modification capabilities.

The choice of expression system should be guided by the specific research question, with consideration for whether structural elements, binding interactions, or channel functionality is the primary focus of investigation.

What evolutionary adaptations in Erinaceus europaeus GJA1 might provide insights into species-specific intercellular communication?

While strong purifying selection has maintained GJA1's core functions across mammals, subtle species-specific adaptations in Erinaceus europaeus GJA1 may reveal important insights into specialized intercellular communication mechanisms.

Evolutionary analysis of GJA1 across mammalian species shows that while the average dN/dS ratio indicates strong purifying selection (approximately 0.024), different lineages exhibit slight variations in evolutionary rates . These variations, though subtle, may reflect adaptive responses to environmental or physiological demands specific to hedgehogs.

Potential areas for investigating Erinaceus europaeus-specific adaptations include:

  • Hibernation-related adaptations: Hedgehogs undergo seasonal hibernation, which requires specific modulation of cardiac gap junctions to maintain minimal but sufficient electrical coupling during torpor states.

  • Thermal regulation mechanisms: GJA1 variations might contribute to specialized thermal regulation necessary for survival in the hedgehog's ecological niche.

  • Immune-related functions: Recent research suggests connexins may play roles in immune responses; hedgehog-specific adaptations might reflect pathogen pressures characteristic to their environment.

  • Developmental timing variations: Species-specific modifications in GJA1 regulatory regions might coordinate with the accelerated or delayed development of certain organ systems in hedgehogs compared to other mammals.

Comparative analysis of Erinaceus europaeus GJA1 with that of related species within the Laurasiatheria clade could reveal specific amino acid substitutions that, while maintaining core functionality, contribute to species-specific adaptations in intercellular communication .

How can researchers distinguish between experimental artifacts and genuine functional characteristics when working with recombinant Erinaceus europaeus GJA1?

Distinguishing between experimental artifacts and genuine functional characteristics when working with recombinant Erinaceus europaeus GJA1 requires a multi-faceted validation approach:

Protein quality assessment protocols:

  • Assess protein homogeneity using size exclusion chromatography to detect aggregation or degradation

  • Verify correct folding through circular dichroism spectroscopy

  • Compare thermal stability profiles with native protein where available

  • Evaluate oligomerization state using native PAGE or analytical ultracentrifugation

Functional validation approaches:

  • Electrophysiological validation: Compare channel conductance properties with native GJA1 or well-characterized orthologs

  • Dye transfer assays: Assess permeability characteristics using fluorescent dyes of varying molecular weights

  • Binding partner verification: Confirm interactions with known GJA1 binding partners (such as those with SH3 or PDZ domains)

  • Phosphorylation response: Verify appropriate phosphorylation patterns in response to regulatory stimuli

Critical controls to implement:

  • Include parallel experiments with well-characterized mammalian GJA1 (e.g., human or mouse) as reference points

  • Employ both positive controls (known functional modulators of GJA1) and negative controls (inactive analogs)

  • Use multiple expression systems to confirm consistent functional properties independent of production method

  • Include experiments with site-directed mutants affecting known functional domains to establish structure-function relationships

By implementing this comprehensive validation framework, researchers can confidently distinguish genuine functional characteristics from artifacts introduced during recombinant protein production and handling.

What optimization strategies should be employed for successful expression and purification of Erinaceus europaeus GJA1?

Successful expression and purification of recombinant Erinaceus europaeus GJA1 requires careful optimization at multiple steps:

Expression system selection and optimization:

  • For full-length functional protein: Mammalian expression systems (HEK293 or CHO cells) are preferable due to their ability to properly fold membrane proteins and perform necessary post-translational modifications .

  • For structural studies of specific domains: E. coli systems may yield higher quantities of domain fragments, such as the C-terminal region (amino acids 233-382) .

  • Codon optimization: Adjust codon usage to match the expression host while preserving critical regulatory elements.

Vector design considerations:

  • Signal peptide selection: Include appropriate signal sequences for membrane targeting.

  • Tag placement: N-terminal tags are generally preferred for GJA1, as C-terminal domains contain regulatory phosphorylation sites and protein interaction motifs .

  • Fusion partner strategies: Consider fusion partners that enhance solubility while maintaining native conformation.

Expression conditions:

  • Temperature modulation: Lower expression temperatures (16-25°C) often improve proper folding of membrane proteins.

  • Induction parameters: For inducible systems, optimize inducer concentration and timing to balance yield with proper folding.

  • Media supplementation: Include specific lipids or chaperone inducers to enhance membrane protein folding.

Purification strategy:
The following purification protocol has proven effective for recombinant GJA1:

Purification StepBuffer CompositionCritical Parameters
Cell lysisTris/PBS-based buffer with protease inhibitorsGentle detergent selection (e.g., DDM or LMNG)
Affinity chromatographyTris/PBS buffer with 5-50% glycerol Imidazole gradient optimization for His-tagged protein
Size exclusionTris/PBS buffer, pH 8.0 with 6% Trehalose Flow rate optimization to maintain oligomeric state
ConcentrationFinal buffer with 5-50% glycerol Avoid protein aggregation during concentration

Storage recommendations:
Store purified recombinant GJA1 at -20°C/-80°C, preferably in aliquots containing 5-50% glycerol to prevent freeze-thaw damage. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What experimental approaches can reveal the structure-function relationship of Erinaceus europaeus GJA1 in comparison with other mammalian orthologs?

Elucidating structure-function relationships of Erinaceus europaeus GJA1 compared to other mammalian orthologs requires a multi-technique approach combining structural analysis with functional assessment:

Structural characterization techniques:

  • Electron crystallography: This approach has successfully resolved the dodecameric channel structure of recombinant cardiac gap junction channels at 7.5 Å in the membrane plane and 21 Å in the vertical direction . Apply similar methods to compare Erinaceus europaeus GJA1 structure with other mammalian orthologs.

  • Cryo-electron microscopy: Recent advances in cryo-EM allow higher resolution analysis of membrane protein complexes, potentially revealing subtle structural differences between species.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of differential conformational dynamics between orthologs, highlighting functionally important domains.

  • X-ray crystallography of domain fragments: While challenging for full-length connexins, crystallography of soluble domains (like the C-terminal tail) can reveal important regulatory regions.

Functional comparative assessment:

  • Electrophysiological characterization: Patch-clamp analysis of cells expressing different GJA1 orthologs can reveal species-specific differences in:

    • Channel conductance

    • Voltage gating properties

    • Response to pH changes

    • Calcium sensitivity

  • Permeability studies: Fluorescent dye transfer assays can quantify differences in molecular selectivity and permeability between orthologs.

  • Interactome mapping: Identify species-specific differences in protein-protein interactions using:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID or APEX)

    • Yeast two-hybrid screening against regulatory proteins

Domain-swapping experiments:
Creating chimeric constructs where specific domains of Erinaceus europaeus GJA1 are exchanged with corresponding regions from other mammalian orthologs can precisely map which structural elements contribute to functional differences.

Site-directed mutagenesis:
Target conserved versus divergent amino acids identified through sequence alignment to determine their contribution to:

  • Channel gating

  • Permeability characteristics

  • Regulatory protein binding

  • Response to post-translational modifications

These complementary approaches will provide comprehensive insights into how structural variations between Erinaceus europaeus GJA1 and other mammalian orthologs translate into functional differences in gap junction communication.

What analytical techniques are most effective for assessing the functional integrity of recombinant Erinaceus europaeus GJA1?

Assessing the functional integrity of recombinant Erinaceus europaeus GJA1 requires a multi-parameter analytical approach that evaluates both structural integrity and functional characteristics:

Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy:

    • Provides information on secondary structure content

    • Can detect significant misfolding of alpha-helical transmembrane domains

    • Enables thermal stability monitoring through temperature-dependent CD measurements

  • Fluorescence spectroscopy:

    • Intrinsic tryptophan fluorescence indicates tertiary structure integrity

    • Binding of environment-sensitive dyes can reveal hydrophobic pocket accessibility

  • Limited proteolysis combined with mass spectrometry:

    • Identifies properly folded domains resistant to proteolytic digestion

    • Maps exposed versus protected regions to confirm expected topology

  • Single-particle electron microscopy:

    • Verifies correct assembly into hexameric connexons

    • Confirms dodecameric channel formation when appropriate

Functional assessment techniques:

  • Dye transfer assays:

    • Gap junction-permeable dyes (Lucifer Yellow, calcein)

    • Size-selective tracers to determine permeability cutoff

    • Methodology: microinjection or "parachute" assay with donor-recipient cell pairs

  • Electrophysiological characterization:

    • Double whole-cell patch clamp for junctional conductance measurement

    • Single-channel recordings to assess conductance states

    • Voltage-step protocols to evaluate gating characteristics

  • Calcium response propagation:

    • Local mechanical or chemical stimulation to initiate calcium waves

    • Real-time calcium imaging to measure intercellular propagation speed and distance

Binding partner interaction verification:

  • Surface plasmon resonance (SPR):

    • Quantitative binding kinetics with known GJA1 interacting partners

    • Compare affinity constants with those of well-characterized orthologs

  • Microscale thermophoresis (MST):

    • Alternative technique for quantifying molecular interactions

    • Requires smaller sample quantities than SPR

  • Biolayer interferometry:

    • Real-time, label-free detection of biomolecular interactions

    • Can be used to screen multiple binding partners efficiently

Data integration approach:
The following data integration protocol enables comprehensive functional assessment:

Assessment CategoryPrimary TechniquesSecondary ValidationExpected Outcome
Structural integrityCD spectroscopy, SEC-MALSLimited proteolysis, EMAlpha-helical content >60%, hexameric/dodecameric assemblies
Channel formationFreeze-fracture EM, AFMNegative staining EMCharacteristic gap junction plaques, 8-9nm particle diameter
Intercellular communicationDye transfer, Ca²⁺ wave propagationMetabolite transferEfficient transfer of <1kDa molecules between cells
Regulatory responsePhosphorylation analysisChannel conductance modulationAppropriate response to PKA, PKC, MAPK signaling

By systematically applying these complementary techniques, researchers can confidently assess whether recombinant Erinaceus europaeus GJA1 maintains the structural organization and functional properties necessary for authentic gap junction communication.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.