Recombinant Erwinia amylovora Amylovoran biosynthesis protein AmsL (amsL)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

AmsL is produced via heterologous expression in E. coli, leveraging the amsL gene cloned into vectors like pETM-11. Key steps include:

  1. Cloning: Forward primer: 5'-CGATCACCATGGTCAATTCAATCTTAGTGG-3'
    Reverse primer: 5'-CGAGAATTCCTATCGGCTTAATGCG-3' .

  2. Expression: Induction with IPTG (isopropyl β-D-1-thiogalactopyranoside).

  3. Purification: Nickel affinity chromatography via His-tag binding.

ParameterDetails
FormLyophilized powder
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
Stability-20°C/-80°C; avoid freeze-thaw cycles
Glycerol Content50% (optional for long-term storage)

Research Significance and Applications

AmsL’s recombinant form enables studies on amylovoran biosynthesis and pathogenicity.

Role in Amylovoran Biosynthesis

  • Operon Context: The ams operon includes glycosyltransferases (e.g., AmsG, AmsB), transport proteins (AmsH, AmsL), and regulatory enzymes (AmsA kinase, AmsI phosphatase) .

  • Functional Hypothesis: AmsL may interact with AmsH or AmsL to facilitate polysaccharide chain elongation or membrane translocation.

Potential Applications

  1. Structure-Function Studies:

    • Crystallization and X-ray diffraction to resolve AmsL’s 3D structure, enabling insights into substrate binding or dimerization.

    • Mutagenesis to identify critical residues for amylovoran production.

  2. Antimicrobial Targeting:

    • Screening for inhibitors that disrupt AmsL-mediated amylovoran assembly, potentially reducing E. amylovora virulence.

  3. Diagnostic Tools:

    • Use of purified AmsL in antibody-based assays to detect E. amylovora infections.

Regulatory Context

The ams operon is regulated by the Rcs phosphorelay system, which activates ams gene expression under stress conditions . While AmsL’s regulation is not explicitly studied, its co-expression with other ams genes suggests shared regulatory mechanisms.

Challenges and Future Directions

  • Functional Elucidation: Direct biochemical assays (e.g., enzymatic activity, lipid carrier interaction) are needed to confirm AmsL’s role.

  • In Vivo Relevance: Testing AmsL mutants in plant infection models to validate its necessity for amylovoran production and virulence.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate special requirements for the format. Please indicate your preferred format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
amsL; Amylovoran biosynthesis protein AmsL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Erwinia amylovora (Fire blight bacteria)
Target Names
amsL
Target Protein Sequence
MSSYIVHRQNITRKEQSTIYWVNVLLSMLTGLLLVAIAWPISWFYHLPQLGGLIMLTSLN FLVLGSLSQYQAHFIKAKRMILLAKIEMVTKFLAFAFTVILLYYSPLGVSAVILGLFANA ALRIGCMIWFGDKSWRPTFEFDQGTFYSSLKYGIYQLGSQTINQLRTQADSLIVGKVMGA ELLGVYSLAKELILQPLKLVTPVINRLALPRFAEKQHDPVRLQQLFLKGTFVIMLFSAIM YLAIGILSPVIVRVLYGPAHEAVGQLIPLMLLFGMLRPMGGLTGAISQANGRTNVEFYWN VVASIIVVLVLASVWIWPQVEYVALTLSISQVLISVFAHPFFIKPVIGIRFLPYARQWIS VSAVFVGIIALVSHYNLFIMPEWFSRWL
Uniprot No.

Target Background

Function
AmsL plays a crucial role in the biosynthesis of amylovoran, a virulence factor.
Protein Families
Polysaccharide synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Erwinia amylovora and what is the significance of amylovoran in its pathogenicity?

Erwinia amylovora is a gram-negative bacterium that causes fire blight disease in apple, pear, and other members of the Rosaceae family . Amylovoran, a high molecular weight acidic heteropolymer exopolysaccharide, serves as a critical virulence factor for this pathogen .

The biosynthesis of amylovoran occurs through the action of proteins encoded by the ams gene cluster, which includes multiple genes responsible for different aspects of exopolysaccharide production. Research has demonstrated that amylovoran production is tightly regulated and directly correlated with the pathogen's virulence capability . Mutants with altered amylovoran production show corresponding changes in their ability to cause disease, confirming its essential role in pathogenicity.

Methodologically, researchers can quantify amylovoran production using the cetylpyridinium chloride (CPC) assay, which provides a standardized approach to measure exopolysaccharide levels across different experimental conditions or mutant strains .

How is amylovoran biosynthesis regulated in Erwinia amylovora?

Amylovoran biosynthesis in E. amylovora is regulated through multiple interconnected mechanisms:

  • Quorum sensing regulation: E. amylovora utilizes N-acyl-homoserine lactone (AHL) signal molecules for cell-density-dependent regulation. This autoinduction system controls virulence traits including the production of extracellular polysaccharides like amylovoran .

  • RcsA/RcsB regulatory system: The activator proteins RcsA and RcsB directly influence the expression of genes in the ams operon. These proteins bind to the promoter region of the amylovoran biosynthesis operon to activate transcription .

  • AmyR regulation: The orphan gene amyR functions as a negative regulator of amylovoran biosynthesis. Knockout of amyR results in approximately eight-fold higher amylovoran production compared to wild-type strains, while overexpression strongly inhibits amylovoran synthesis .

The interplay between these regulatory systems ensures precise control of amylovoran production in response to environmental cues and physiological states, optimizing the pathogen's fitness during infection.

What genes are involved in the amylovoran biosynthesis gene cluster?

The amylovoran biosynthesis gene cluster (ams) contains multiple genes that coordinate the complex process of exopolysaccharide synthesis. Key components identified in research include:

GeneProtein SizeFunctionRegulatory Influence
amsI17 kDa (144 aa)Acid phosphatase activityAffected by RcsA/RcsB
eamI-AHL synthaseAutoinduction regulation
eamR-Similar to LuxR AHL activatorQuorum sensing regulation
amyR-Negative regulatorInhibits ams gene expression

The amsI gene encodes a 144 amino acid protein with homology to mammalian low molecular weight acid phosphatases . This represents the first reported low molecular weight acid phosphatase in prokaryotes. The protein participates in phosphorylation changes required for exopolysaccharide biosynthesis, potentially recycling the lipid carrier diphosphate to the monophosphate form .

While the specific function of AmsL is not directly addressed in the available research results, it likely plays a coordinated role with other ams genes in the biosynthesis pathway.

What experimental approaches can be used to characterize the function of AmsL protein?

Characterizing AmsL function requires a multi-faceted experimental approach:

  • Gene knockout and complementation studies: Creating amsL deletion mutants followed by phenotypic characterization of amylovoran production, biofilm formation, and virulence. Complementation with intact amsL would confirm phenotype specificity.

  • Protein expression and purification: Similar to studies with AmsI (which was cloned under lac promoter control on a high copy number plasmid), AmsL can be heterologously expressed with affinity tags for purification and subsequent biochemical analysis .

  • Enzymatic activity assays: Based on homology predictions and pathway analysis, specific biochemical assays can be designed to test the enzymatic function of purified AmsL.

  • Transcriptional analysis: qRT-PCR or RNA-Seq to examine how amsL expression correlates with other genes in the amylovoran biosynthesis pathway under various conditions, similar to observations made with amyR .

  • Protein-protein interaction studies: Co-immunoprecipitation or bacterial two-hybrid systems to identify binding partners within the amylovoran biosynthesis complex.

The comprehensive approach would integrate genetic, biochemical, and structural studies to build a complete understanding of AmsL's role in amylovoran biosynthesis.

How can recombinant AmsL protein be optimally expressed and purified for structural studies?

Based on successful approaches with related proteins in E. amylovora, the following methodological pipeline is recommended for AmsL expression and purification:

  • Expression system selection:

    • E. coli BL21(DE3) strain typically provides high yields for heterologous bacterial proteins

    • Vectors containing T7 or tac promoters allow for controlled induction

    • Fusion tags (His6, GST, or MBP) facilitate purification and can enhance solubility

  • Optimization of expression conditions:

    • Test multiple induction temperatures (16°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Determine optimal induction duration (3-24 hours)

  • Purification strategy:

    • Initial capture via affinity chromatography (Ni-NTA for His-tagged proteins)

    • Secondary purification via ion exchange chromatography

    • Final polishing step using size exclusion chromatography

  • Protein characterization:

    • SDS-PAGE and Western blotting to confirm identity

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism for secondary structure analysis

  • Crystallization trials:

    • Screening diverse conditions with commercial crystallization kits

    • Optimization of promising conditions for X-ray diffraction studies

Notably, the related protein AmsI has been successfully crystallized and its structure determined at 1.57 Å resolution , providing a methodological template for AmsL structural studies.

What are the potential interactions between AmsL and other proteins in the amylovoran biosynthesis pathway?

Understanding protein-protein interactions in the amylovoran biosynthesis complex is crucial for elucidating the complete pathway mechanism. While specific AmsL interactions are not directly described in the available literature, potential interactions can be predicted based on related systems:

  • Regulatory interactions: AmsL may interact with the RcsA/RcsB regulatory system, as demonstrated for other ams genes . This interaction would place AmsL under similar transcriptional control as other genes in the amylovoran biosynthesis cluster.

  • Enzymatic complex formation: AmsL likely functions as part of a multi-protein complex involved in polysaccharide synthesis. Proteins in the same pathway often form physical interactions to facilitate substrate channeling and enhance reaction efficiency.

  • Membrane association: Many proteins involved in exopolysaccharide biosynthesis associate with the bacterial membrane, where polymerization and export occur. AmsL may interact with membrane proteins that facilitate export of the growing amylovoran polymer.

Research approaches to identify these interactions include:

  • Bacterial two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET) between tagged proteins

  • Cross-linking studies coupled with proteomics

These methodologies would provide a comprehensive interactome map of the amylovoran biosynthesis pathway.

How does quorum sensing influence AmsL expression and function?

Quorum sensing plays a critical role in regulating virulence factors in E. amylovora, including amylovoran production. The relationship between quorum sensing and AmsL can be understood through several findings:

  • E. amylovora produces N-acyl-homoserine lactone (AHL) signal molecules that accumulate in a cell-density-dependent manner . These signals are detected by standard autoinducer biosensors, including Agrobacterium tumefaciens NTL4 and Vibrio harveyi BB886 .

  • Two major virulence traits—production of extracellular polysaccharides (including amylovoran) and tolerance to free oxygen radicals—are controlled in a cell-density-dependent manner through this quorum sensing system .

  • The AHL synthase gene (eamI) and a cognate regulator (eamR) have been identified in E. amylovora, with homology to autoinducer genes from other bacterial pathogens .

  • Disruption of quorum sensing through expression of the Bacillus sp. acyl-homoserine lactonase gene (aiiA) abolishes AHL production, impairs polysaccharide synthesis, and reduces virulence .

What contradictions exist in current research data regarding amylovoran biosynthesis pathways?

Several apparent contradictions have been observed in research on amylovoran biosynthesis that warrant further investigation:

  • Dual role of biosynthesis proteins: The AmsI protein exhibits acid phosphatase activity, yet both overexpression and mutation of amsI result in reduced exopolysaccharide synthesis . This seemingly contradictory finding suggests complex regulatory mechanisms that are not fully understood.

  • Inverse correlation between regulators: While AmyR functions as a negative regulator of amylovoran production, it shows an inverse relationship with levan production (another exopolysaccharide). Both knockout and overexpression of amyR reduce levan synthesis , indicating divergent regulatory pathways for different exopolysaccharides.

  • Virulence-exopolysaccharide correlation: Although amylovoran is considered a virulence factor, the relationship between production levels and virulence is not strictly linear. The amyR knockout mutant produces eight-fold more amylovoran but only shows slightly increased virulence compared to wild-type .

These contradictions highlight the complexity of exopolysaccharide biosynthesis regulation and underscore the need for systematic investigation of each component in the pathway. A structured analysis approach, as suggested by research on contradiction patterns in biomedical data , could help resolve these apparent conflicts by identifying the minimal number of underlying rules that explain the observed phenomena.

How can knowledge of AmsL function contribute to fire blight disease management strategies?

Understanding AmsL function within the amylovoran biosynthesis pathway presents several potential applications for fire blight disease management:

  • Target-based inhibitor development: Detailed structural and functional characterization of AmsL could enable rational design of small molecule inhibitors that specifically disrupt amylovoran production without affecting beneficial microorganisms in the plant microbiome.

  • Biocontrol strategies: Engineering beneficial bacteria to express compounds that interfere with AmsL function could provide sustainable biocontrol options. Similar approaches targeting quorum sensing have shown promise in reducing virulence .

  • Host resistance engineering: Plants could potentially be engineered to produce inhibitors of AmsL or other amylovoran biosynthesis proteins as part of their immune response upon pathogen detection.

  • Diagnostic development: Knowledge of AmsL function could lead to improved diagnostic tools for early detection of E. amylovora based on specific proteins or metabolites in the amylovoran biosynthesis pathway.

The methodological approach would involve initial basic research on protein function, followed by translational studies testing specific interventions in controlled environments before field implementation.

What bioinformatic approaches can predict functional domains and evolutionary relationships of AmsL?

Modern bioinformatic analyses can provide valuable insights into AmsL function through multiple computational approaches:

  • Sequence-based analysis:

    • Multiple sequence alignment with homologous proteins

    • Hidden Markov Model (HMM) profiles for domain identification

    • Signal peptide and transmembrane domain prediction

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structure-based function prediction through comparison with known protein folds

    • Active site identification and binding pocket analysis

  • Evolutionary analysis:

    • Phylogenetic reconstruction of AmsL across bacterial species

    • Selection pressure analysis to identify functionally important residues

    • Synteny analysis of the genomic context of amsL across related organisms

  • Systems biology integration:

    • Protein-protein interaction network prediction

    • Metabolic pathway modeling incorporating AmsL function

    • Gene co-expression analysis across different conditions

These computational approaches would generate testable hypotheses about AmsL function that could guide experimental design, potentially revealing unexpected roles or relationships within the amylovoran biosynthesis pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.