Recombinant Erwinia amylovora Glucitol/sorbitol permease IIC component (srlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
srlA; PTS system glucitol/sorbitol-specific EIIC component; EIIC-Gut; Glucitol/sorbitol permease IIC component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Erwinia amylovora (Fire blight bacteria)
Target Names
srlA
Target Protein Sequence
MIEAITHGAEWFIGLFQKGGEVFVGMVTGILPLLISLLVIMNALIVFVGQRRIEKLAQKC AGNPVTRYLVLPFIGTFVFCNPMTHSLGKFLPEKYKPSYYAAASYSCHSMNGLFPHINPG ELFVYLGIANGLTTLGVPLGPLAVSYLLVGLITNFFRGWVTDLTTSVFEKKMGIKLDKSV HL
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a primary carbohydrate transport system, catalyzes the phosphorylation and translocation of sugar substrates across the cell membrane. The enzyme II complex, consisting of SrlA, SrlB, and SrlE, facilitates glucitol/sorbitol transport.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of the glucitol/sorbitol permease IIC component (srlA) in Erwinia amylovora?

The glucitol/sorbitol permease IIC component, encoded by the srlA gene, is part of the phosphotransferase system (PTS) in Erwinia amylovora. This system facilitates the uptake and phosphorylation of sugar alcohols like sorbitol, which are crucial for the bacterium's metabolism and pathogenicity. Sorbitol serves as a primary carbohydrate source in host plants such as apple and pear, making it a critical factor in host-pathogen interactions . The PTS system not only transports sorbitol but also regulates its utilization through a series of enzymatic steps. This dual role underscores its importance in bacterial survival and virulence during infection.

How does the expression of srlA influence the virulence of Erwinia amylovora?

The expression of srlA is tightly regulated and is influenced by the availability of sorbitol in the environment. Studies have shown that mutants deficient in sorbitol metabolism retain virulence on certain host tissues, such as immature pear slices, but exhibit significantly reduced pathogenicity on apple shoots . This suggests that sorbitol metabolism mediated by srlA contributes to host specificity and disease severity. The regulatory mechanisms controlling srlA expression involve global transcriptional regulators that respond to environmental cues, aligning metabolic activity with infection processes.

What experimental approaches can be used to study the function of srlA in bacterial metabolism?

To investigate the function of srlA, researchers can employ several experimental techniques:

  • Gene Knockout Studies: Creating deletion mutants for srlA allows for the assessment of its role in sorbitol uptake and metabolism. Complementation experiments using plasmid-borne copies of srlA can confirm its specific function .

  • Transcriptional Analysis: Techniques such as quantitative PCR (qPCR) or RNA-Seq can be used to measure srlA expression under different environmental conditions, such as varying sugar concentrations .

  • Protein Characterization: Recombinant expression of the srlA protein followed by purification enables in vitro studies of its biochemical properties and substrate specificity .

  • Phenotypic Assays: Growth assays in media containing sorbitol as the sole carbon source can reveal functional impairments in mutants lacking srlA .

These methods provide a comprehensive understanding of srlA's role in bacterial physiology.

How does sorbitol metabolism affect host-pathogen interactions in fire blight disease?

Sorbitol metabolism plays a pivotal role in determining host specificity and disease progression in fire blight caused by Erwinia amylovora. Sorbitol is a major carbohydrate transported within host plants like apple and pear, serving as an energy source for bacterial proliferation . The ability to metabolize sorbitol via the PTS system, including the srlA component, enables the pathogen to exploit host resources effectively. Mutants deficient in sorbitol metabolism exhibit attenuated virulence, highlighting its importance in successful colonization and infection . Additionally, sorbitol metabolism may influence bacterial signaling pathways that regulate virulence factor expression.

What are the regulatory mechanisms controlling srlA expression?

The expression of srlA is regulated by multiple factors:

  • Carbon Catabolite Repression: The presence of glucose represses srlA expression, prioritizing glucose metabolism over sorbitol utilization .

  • Environmental Cues: Sorbitol availability induces srlA expression, aligning metabolic activity with nutrient availability .

  • Global Regulators: Transcriptional regulators such as HrpL indirectly influence srlA expression by modulating downstream signaling networks involved in virulence .

Understanding these regulatory mechanisms provides insights into how metabolic pathways are integrated with pathogenic strategies.

How can recombinant srlA protein be used in experimental studies?

Recombinant srlA protein can be utilized for various applications:

  • Biochemical Characterization: Purified recombinant protein enables studies on substrate binding affinity, transport kinetics, and enzymatic activity .

  • Structural Analysis: Techniques such as X-ray crystallography or cryo-electron microscopy can elucidate the protein's three-dimensional structure, revealing functional domains critical for its activity.

  • Antibody Production: Recombinant srlA can serve as an antigen for generating specific antibodies used in immunodetection assays.

These applications facilitate a deeper understanding of srlA's role at molecular and cellular levels.

What challenges exist when studying the srl operon in Erwinia amylovora?

Research on the srl operon faces several challenges:

  • Functional Redundancy: Homologous genes within related operons may compensate for mutations, complicating functional analyses.

  • Regulatory Complexity: The interplay between local and global regulators requires sophisticated experimental designs to dissect their roles.

  • Host-Specific Factors: Variability in host plant physiology can influence experimental outcomes, necessitating controlled conditions for reproducibility.

Addressing these challenges involves employing advanced genetic tools and robust experimental designs.

How do mutations in the srl operon affect bacterial fitness?

Mutations disrupting the srl operon impair sorbitol uptake and metabolism, affecting bacterial growth under nutrient-limiting conditions where sorbitol is the sole carbon source . These mutants also exhibit reduced virulence on certain host plants, indicating that efficient carbohydrate utilization is essential for pathogenic success . Complementation studies with functional copies of srl genes can restore these phenotypes, confirming their specific roles.

Can microarray or transcriptomic data provide insights into srlA regulation?

Yes, transcriptomic analyses using microarrays or RNA-Seq have identified differential expression patterns for srl genes under various conditions . For example, studies have shown that HrpL-regulated genes include components involved in carbohydrate metabolism like srlA . These datasets enable researchers to link metabolic pathways with regulatory networks governing virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.