Recombinant Erwinia amylovora UDP-galactose-lipid carrier transferase (amsG)

Shipped with Ice Packs
In Stock

Description

Introduction to AmsG

AmsG (encoded by the amsG gene) is a UDP-galactose-lipid carrier transferase that catalyzes the transfer of galactose from UDP-galactose to a lipid carrier during amylovoran biosynthesis . Amylovoran serves as a virulence factor, enabling bacterial colonization and obstruction of plant vascular systems . Recombinant AmsG refers to the enzyme produced via heterologous expression systems for functional and structural studies.

Functional Role in Amylovoran Biosynthesis

AmsG operates within the 12-gene ams cluster (amsA–amsL) . Key functions include:

  • Subunit Assembly: Anchors galactose to a lipid carrier, forming repeating oligosaccharide units of amylovoran .

  • Regulation: Expression is modulated by cyclic di-GMP (c-di-GMP) via CsrD, which stabilizes amsG mRNA .

  • Virulence Link: Mutants lacking amsG show reduced amylovoran production and impaired pathogenicity .

Recombinant Production

Recombinant AmsG is typically expressed in Escherichia coli for biochemical studies:

  • Cloning: The amsG gene is amplified from E. amylovora and ligated into expression vectors (e.g., pET series) .

  • Purification: Affinity chromatography tags (e.g., His-tag) enable high-yield isolation .

  • Activity Assays: Measured via UDP-galactose consumption or lipid-linked galactose detection .

Table 1: Key Studies on AmsG

Study FocusFindingsSource
Transcriptional RegulationamsG expression is upregulated by c-di-GMP and downregulated in csrD mutants.
CRISPR GenotypingamsG confirmed as a stable virulence marker in E. amylovora isolates.
Structural AnalysisAmsG shares homology with undecaprenyl-phosphate galactose phosphotransferases.

Table 2: Impact of AmsG on Virulence

ConditionEffect on AmylovoranPathogenicity
amsG overexpressionIncreased EPS productionEnhanced tissue necrosis .
amsG knockoutReduced EPS synthesisAttenuated disease progression .

Significance and Applications

  • Biocontrol Strategies: Targeting AmsG could disrupt amylovoran synthesis, reducing bacterial virulence .

  • Agricultural Research: CRISPR-based genotyping of amsG aids in tracking E. amylovora outbreaks .

  • Enzyme Engineering: Recombinant AmsG serves as a model for studying glycosyltransferase mechanisms .

Challenges and Future Directions

  • Stability Issues: Recombinant AmsG is sensitive to proteolytic degradation .

  • Structural Insights: Cryo-EM or X-ray crystallography could elucidate substrate-binding dynamics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
amsG; UDP-galactose-lipid carrier transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Erwinia amylovora (Fire blight bacteria)
Target Names
amsG
Target Protein Sequence
MREIEFTFKGLLIRLSLALSDLIFFNIALALAIVLINGFPGEILTGIPQHELDLKIATHI LLSVICVGWFWVRLRHYTYRKPFWFELKEVFRTILIFSIVDLSVSALSKWELSRWIWILT WLLSMAMVPFGRACVKRLLNRKKLWKKQSIIIGSGKNAQEAWQALQSEEMMGFDVIAFYD VDGSQTALELFGVPVLKEEQQLWSLVDSDTQFIVAVEYEQSQSRDRWLKNLATHNCRSVS VIPSLRGVPLYGTDMAYIFSHEVMILRVSNNLAKHSSRFLKRTFDLVGALSIITLLLPAL VILIFMVSRDGGAPIYGHERVGRDGRKFKCLKFRSMVVNSKEVLEEVLRTDPVARAEWDE DFKLKNDPRITRIGHFIRKTSLDELPQLWNVVRGEMSLVGPRPVIEAELERYAGDVDYYF MAKPGMTGLWQVSGRNDVSYETRVYFDSWYVKNWSLWNDIAILFKTIGVVLKRDGAY
Uniprot No.

Target Background

Function
This protein plays a role in the biosynthesis of amylovoran, a virulence factor. It may act as a sugar transferase and could be involved in the export of the repeating unit by flipping the lipid carrier to the periplasmic face of the inner membrane.
Protein Families
Bacterial sugar transferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.