Recombinant Erwinia carotovora subsp. atroseptica Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is selected during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
argO; ECA3909; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
argO
Target Protein Sequence
MWAVYLQGVLLGAAMILPLGPQNAFVMNQGIRRQYHLMVALLCAVSDMVLISAGIFGGSA LLNQSSLLLGAVTCGGVAFLLWFGWGAMKTAFSKNIALTSADVMKQSRWRIIATMLAVTW LNPHVYLDTFVVLGSLGSQFADDARRWFALGTMTASFTWFFALALLAAWLAPWLNTPRVQ RVINFFVGMVMWGIALQLARHGWQ
Uniprot No.

Target Background

Function
ArgO, the arginine exporter protein from Erwinia carotovora subsp. atroseptica, plays a crucial role in arginine export. Its function is essential for regulating intracellular arginine levels and maintaining the appropriate balance between arginine and lysine.
Database Links

KEGG: eca:ECA3909

STRING: 218491.ECA3909

Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia carotovora subsp. atroseptica and why is it significant in molecular research?

Erwinia carotovora subsp. atroseptica is a gram-negative bacterial plant pathogen that belongs to the Enterobacteriaceae family. It is particularly significant in molecular research due to its genetic tractability and important role in plant pathology. The bacterium causes blackleg disease in potatoes and other crops, making it an important model organism for studying plant-pathogen interactions and bacterial virulence mechanisms.

The species has proven amenable to genetic transformation using modified versions of established protocols. Research has demonstrated successful transformation frequencies ranging from 1 × 10² to 4 × 10⁴ colonies per microgram of plasmid DNA using ColE1-based plasmids such as pBR322, pBR325, and pAT153 . This transformability makes it valuable for studying gene function, including membrane transport proteins like ArgO.

What is the function of the Arginine exporter protein ArgO in bacterial systems?

The Arginine exporter protein ArgO (argO) functions as a transmembrane protein responsible for the export of arginine from the bacterial cell. As part of the amino acid export system, ArgO plays critical roles in:

  • Maintaining intracellular arginine homeostasis

  • Contributing to bacterial stress responses, particularly during amino acid imbalance

  • Participating in complex regulatory networks that respond to environmental changes

  • Potentially influencing pathogenicity through control of amino acid availability

ArgO belongs to a class of membrane transporters that typically utilize energy from cellular metabolites to drive the export process against concentration gradients. While general characteristics can be inferred from homologs in other bacterial species, the specific characteristics of ArgO from E. carotovora subsp. atroseptica require targeted experimental investigation.

What expression systems are most suitable for recombinant ArgO production?

The optimal expression system for recombinant ArgO production depends on research objectives and protein characteristics. Based on successful recombinant protein expression of other E. carotovora proteins, the following systems merit consideration:

  • E. coli expression systems: Various E. coli strains have demonstrated efficacy for recombinant protein production from E. carotovora. For instance, high enzyme activities (~98,000 U/L) of recombinant E. carotovora L-asparaginase II were achieved using DO-stat feeding strategies in E. coli cultures . This suggests E. coli as a viable host for ArgO expression, especially when employing:

    • BL21(DE3) and derivatives for improved membrane protein expression

    • Controlled induction parameters, with induction timing being critical (optimal induction at 18h demonstrated for L-asparaginase II)

    • Specialized vectors containing solubility-enhancing fusion tags

  • Homologous expression: Expression within E. carotovora itself may preserve native folding and post-translational modifications, though transformation efficiencies (1 × 10² to 4 × 10⁴ colonies per microgram) are lower than in E. coli .

  • Alternative systems: For structural studies requiring extensive post-translational modifications, eukaryotic expression systems may be considered, though with recognition of lower yields.

What transformation methods have proven effective for genetic manipulation of Erwinia carotovora subsp. atroseptica?

Successful transformation of E. carotovora subsp. atroseptica has been achieved using modified versions of established protocols. The most effective approach documented is a modified Hanahan method, which yielded transformation frequencies ranging from 1 × 10² to 4 × 10⁴ colonies per microgram of plasmid DNA . This method has been validated with several plasmids including pBR322, pBR325, and pAT153.

The transformation protocol typically involves:

  • Growing bacterial cells to early-to-mid log phase (OD₆₀₀ of 0.4-0.6)

  • Harvesting cells by centrifugation at low speed (3,000-4,000 × g)

  • Washing cells with cold, sterile CaCl₂ solution (typically 50-100 mM)

  • Incubating cells with plasmid DNA on ice

  • Heat-shocking the cells (42°C for 90 seconds is common)

  • Recovery in non-selective media

  • Plating on selective media containing appropriate antibiotics

ColE1-based plasmids have proven particularly useful as cloning vectors for E. carotovora subsp. atroseptica, making them potential candidates for ArgO expression constructs . The effectiveness of transposon mutagenesis using Tn5 has also been documented, providing another valuable tool for genetic manipulation.

How can recombinant ArgO protein expression be optimized in fed-batch cultivation?

Optimizing recombinant ArgO expression in fed-batch cultivation requires careful control of multiple parameters. Drawing from successful expression strategies for other E. carotovora proteins, the following approach is recommended:

  • Feeding strategy selection: The DO-stat (dissolved oxygen) feeding strategy has shown excellent results for recombinant E. carotovora proteins, with productivity reaching 3260 U/(L·h) for L-asparaginase II . This approach maintains optimal dissolved oxygen levels by adjusting feed rate in response to metabolic activity.

  • Induction timing: Optimal induction timing is critical. For L-asparaginase II, induction at 18h of culture yielded maximum enzyme activities (~98,000 U/L) . For membrane proteins like ArgO, induction during mid-to-late logarithmic phase typically balances yield with proper folding.

  • Temperature modulation: Post-induction temperature reduction (typically to 18-25°C) often improves membrane protein folding and reduces inclusion body formation.

  • Feed formulation: Complex feed formulations containing glucose (primary carbon source), trace elements, and nitrogen sources support high cell density cultivation. Key parameters achieved for other E. carotovora proteins include:

    • Maximum biomass: 30.7 g dry cell weight per liter

    • Protein yield: 0.9 g soluble protein per liter

    • Productivity: 3260 U/(L·h)

    • Yield per substrate: 1204 U/g glucose

    • Yield per biomass: 3660 U/g cells

  • Inducer concentration: Titration of inducer (IPTG for T7-based systems) concentrations between 0.1-1.0 mM can identify optimal levels that balance expression with proper folding.

What purification strategies are most effective for membrane proteins like ArgO?

Purification of membrane proteins like ArgO presents unique challenges due to their hydrophobic nature and requirement for detergents. An effective purification strategy includes:

  • Membrane fraction isolation:

    • Cell disruption via sonication or high-pressure homogenization

    • Differential centrifugation to isolate membrane fractions (typically 100,000 × g ultracentrifugation)

    • Solubilization of membrane fractions with appropriate detergents (n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or lauryl maltose neopentyl glycol (LMNG))

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Carefully formulated buffers containing detergent at concentrations above critical micelle concentration (CMC)

    • Step or linear imidazole gradients for elution

  • Secondary purification:

    • Size exclusion chromatography (SEC) to separate protein-detergent complexes

    • Ion exchange chromatography with detergent-supplemented buffers

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity

    • Analytical SEC to verify monodispersity

    • Activity assays to confirm function

For ArgO specifically, purification success depends heavily on detergent selection. Screening multiple detergents is recommended, as membrane protein stability varies significantly between detergent classes.

How can protein-protein interaction studies be designed to identify ArgO binding partners?

Understanding ArgO's interaction network requires specialized approaches for membrane protein interaction studies:

  • Chemical cross-linking mass spectrometry (CXMS):

    • Bifunctional aromatic glyoxal cross-linkers (ArGOs) can be employed for arginine-selective cross-linking

    • Lysine-arginine cross-linker KArGO provides additional coverage of protein-protein interfaces

    • Cross-linked samples undergo protease digestion, LC-MS/MS analysis, and computational identification of cross-linked peptide pairs

    • This approach is particularly valuable for membrane proteins as it can capture transient interactions

  • Membrane yeast two-hybrid (MYTH) system:

    • Split-ubiquitin based system allows detection of membrane protein interactions

    • ArgO would be fused to one half of ubiquitin and a transcription factor

    • Interaction partners fused to complementary ubiquitin fragment

    • Reconstitution of ubiquitin upon interaction leads to transcription factor release and reporter gene activation

  • Proximity labeling approaches:

    • BioID or APEX2 fusions to ArgO can biotinylate proximal proteins

    • Subsequent purification of biotinylated proteins and MS identification reveals interaction neighborhood

    • Time-resolved experiments can distinguish stable from transient interactions

  • Co-purification studies:

    • Gentle solubilization conditions preserve protein-protein interactions

    • Tandem affinity purification followed by MS identification

    • Reciprocal tagging verifies interactions

Each method has strengths and limitations, with CXMS offering particular advantages for membrane proteins due to its ability to work in near-native conditions and provide distance constraints for structural modeling.

What strategies can address challenges in structural characterization of membrane proteins like ArgO?

Structural characterization of membrane proteins like ArgO presents significant challenges due to their hydrophobic nature. Several complementary approaches can overcome these limitations:

  • Cryo-electron microscopy:

    • Vitrification of purified protein in detergent micelles or nanodiscs

    • Single particle analysis for structure determination

    • No size limitation and minimal sample requirements compared to crystallography

  • X-ray crystallography with specialized approaches:

    • Lipidic cubic phase (LCP) crystallization

    • Addition of stabilizing antibody fragments

    • Thermal stability screening to identify optimal detergent conditions

  • Integrated chemical cross-linking with mass spectrometry:

    • Arginine-selective cross-linkers (ArGOs) provide valuable distance constraints

    • KArGO cross-linkers (lysine-arginine) offer complementary information not attainable by traditional lysine-lysine cross-linkers

    • Integration of cross-linking data with computational modeling improves accuracy of structural predictions

    • Cross-link data can substantially improve the accuracy of Rosetta docking for protein complexes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Provides information on protein dynamics and solvent accessibility

    • Compatible with detergent-solubilized membrane proteins

    • Identifies regions involved in ligand binding or conformational changes

  • NMR spectroscopy:

    • Solution NMR for smaller membrane proteins or domains

    • Solid-state NMR for larger systems in lipid environments

    • Provides dynamic information not available from static structures

A combined approach using multiple techniques often provides the most comprehensive structural understanding, with cross-linking mass spectrometry serving as a valuable bridge between low and high-resolution methods.

How does temperature affect recombinant ArgO expression and functionality?

Temperature regulation is a critical parameter in recombinant membrane protein expression that affects both yield and functionality:

  • Expression temperature effects:

    • Standard growth temperatures (37°C) typically maximize biomass production but often lead to inclusion body formation for membrane proteins

    • Reduced temperatures (18-25°C) slow protein synthesis, allowing more time for proper membrane insertion and folding

    • Ultra-low temperature protocols (16°C) can significantly improve the ratio of properly folded to aggregated protein for challenging membrane proteins

  • Impact on protein folding and membrane insertion:

    • Temperature directly affects membrane fluidity, which influences protein insertion efficiency

    • The bacterial Sec translocon, responsible for membrane protein insertion, operates more effectively at lower temperatures for overexpressed proteins

    • Chaperone availability and activity are temperature-dependent, affecting ArgO folding trajectories

  • Functionality considerations:

    • Protein activity assays should be performed at physiologically relevant temperatures (typically 25-30°C for E. carotovora proteins)

    • Temperature-activity profiles should be established to identify optimal conditions for functional studies

    • Thermal stability assessments (using methods like thermofluor assays) can predict long-term protein stability

  • Experimental optimization approach:

    Temperature (°C)Expected Effect on ArgO ExpressionRecommended Induction OD₆₀₀Typical Induction Duration
    37High expression, potential inclusion bodies0.6-0.83-4 hours
    30Balanced expression and folding0.8-1.05-6 hours
    25Improved folding, moderate expression0.8-1.08-10 hours
    18Optimal folding, lower expression1.0-1.216-20 hours
    16Maximum folding quality, minimal expression1.0-1.220-24 hours

For initial expression trials, a temperature series experiment is recommended, with subsequent functional characterization to identify optimal conditions that balance yield with proper folding and activity.

What analytical methods are most appropriate for assessing ArgO purity and activity?

A multi-faceted analytical approach is essential for comprehensive characterization of recombinant ArgO:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (expected sensitivity: detection of ≥50 ng protein)

    • Western blotting using anti-His tag or protein-specific antibodies (sensitivity to <10 ng protein)

    • Size exclusion chromatography to assess monodispersity and oligomeric state

    • Mass spectrometry for identity confirmation and detection of post-translational modifications

  • Activity assays:

    • Arginine transport assays using either:
      a) Radioactive arginine uptake/export measurements
      b) Fluorescent arginine analogs with spectrofluorometric detection

    • Membrane reconstitution systems (proteoliposomes) to measure directional transport

    • Isothermal titration calorimetry (ITC) to determine substrate binding parameters (similar to approaches used for L-asparaginase II, where Km values for substrates were determined to be 33×10⁻⁶ M for the primary substrate)

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to assess folding quality

    • Tryptophan fluorescence to monitor tertiary structure

  • Homogeneity assessment:

    • Analytical ultracentrifugation to determine sedimentation coefficient and molecular weight

    • Dynamic light scattering to assess size distribution

    • Native PAGE to evaluate oligomeric state

For membrane proteins like ArgO, detergent screening is often integrated into the analytical workflow to identify conditions that maintain structural integrity and functional activity. A minimum of three complementary techniques should be employed to confirm protein quality before proceeding to detailed functional studies.

How can researchers effectively troubleshoot low expression yields of recombinant ArgO?

Troubleshooting low expression yields of membrane proteins like ArgO requires systematic investigation of multiple factors:

  • Construct design optimization:

    • Codon optimization for the expression host (typically improving GC content and avoiding rare codons)

    • Addition of solubility-enhancing fusion partners (MBP, SUMO, or Mistic for membrane proteins)

    • Truncation constructs removing flexible regions to improve stability

    • Signal sequence optimization to enhance membrane targeting

  • Expression host selection:

    • Testing multiple E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

    • Evaluating expression in the native organism (E. carotovora) using compatible plasmids

    • Considering eukaryotic hosts for complex membrane proteins

  • Expression conditions optimization:

    • Temperature screening (16-37°C)

    • Inducer concentration titration (0.01-1.0 mM IPTG)

    • Media composition (defined vs. complex media)

    • Feed strategy modification in bioreactor settings (DO-stat feeding strategy showed excellent results for other E. carotovora proteins)

  • Systematic troubleshooting workflow:

    ProblemPotential CausesDiagnostic ApproachSolution Strategies
    No detectable expressionToxicity of ArgO to hostGrowth curve comparisonTighter promoter control, lower temperature
    Plasmid instabilityPlasmid recovery and restriction analysisAlternative vectors, reduced copy number
    Expression only in insoluble fractionImproper membrane insertionMembrane fractionation analysisSlower expression rate, fusion partners
    Inadequate chaperone capacityCo-expression with chaperonesLower temperature, chaperone co-expression
    Degradation of expressed proteinProtease sensitivityPulse-chase experimentsProtease-deficient strains, protease inhibitors
    Low biomass yieldMetabolic burdenMonitoring growth parametersFed-batch cultivation, controlled induction
  • Advanced rescue strategies:

    • Directed evolution approaches to select for better-expressing variants

    • Chaperone co-expression systems

    • Specialized membrane protein expression vectors

    • Implementation of robust fed-batch cultivation methods that achieved high yields (30.7 g dry cell weight/L) for other E. carotovora proteins

What experimental controls are essential when studying recombinant ArgO function?

Rigorous experimental design for ArgO functional studies requires carefully selected controls to ensure valid interpretations:

  • Negative controls:

    • Inactive ArgO mutants (e.g., site-directed mutagenesis of conserved residues)

    • Empty vector/untransformed host cells to establish baseline measurements

    • Heat-inactivated protein preparations to distinguish specific from non-specific effects

    • Detergent-only controls for membrane protein studies

  • Positive controls:

    • Well-characterized arginine transporters from related organisms

    • Native ArgO purified from E. carotovora when feasible

    • Known arginine transport inhibitors with established effects

  • Specificity controls:

    • Transport assays with structurally similar but non-substrate amino acids

    • Competition assays with unlabeled substrates

    • pH and ion dependency profiles to establish mechanism

  • System validation controls:

    • Reconstitution controls (protein-free liposomes)

    • Membrane integrity verification

    • Orientation controls for directional transport studies

  • Controls for specific techniques:

    • For CXMS studies: non-cross-linked samples, analysis of mono-linked peptides to verify reaction efficiency

    • For binding studies: heat-denatured protein to distinguish specific from non-specific binding

    • For activity assays: enzyme kinetics controls including substrate saturation curves

  • Recommended control experiments workflow:

    Experimental ApproachEssential ControlsValidation Criteria
    Expression analysisEmpty vector, housekeeping geneSpecific band at expected MW, absence in negative control
    PurificationMock purification from non-expressing cellsAbsence of protein in negative control
    Transport assaysNo-protein liposomes, scrambled membrane proteinSignal-to-noise ratio >3, specificity for arginine
    Binding studiesHeat-denatured protein, non-cognate ligandsSpecific binding with expected affinity constants
    Structural analysisDetergent-only samples, reference proteinsSpectral characteristics matching prediction

For each control type, quantitative acceptance criteria should be established before experimental work begins to ensure objective interpretation of results.

How does ArgO from E. carotovora subsp. atroseptica compare with arginine exporters from other bacterial species?

A comprehensive comparison of bacterial arginine exporters reveals important structural and functional relationships:

  • Evolutionary relationships:

    • ArgO belongs to the Lysine exporter (LysE) family of transmembrane proteins

    • Sequence homology analysis typically shows 30-60% identity with ArgO proteins from other Enterobacteriaceae

    • Greater divergence (15-30% identity) observed with arginine exporters from Gram-positive bacteria

  • Structural comparisons:

    • ArgO typically contains 5-6 transmembrane domains with cytoplasmic N and C termini

    • Conserved arginine residues in transmembrane domains 2 and 4 are often critical for substrate recognition

    • Species-specific variations in the periplasmic loops can influence substrate specificity and transport kinetics

  • Functional parameters comparison:

    SpeciesKm for ArginineTransport RateRegulatory MechanismpH Optimum
    E. carotovora subsp. atrosepticaPredicted: 10-50 μM*To be determinedArgR repressorPredicted: 6.5-7.5*
    E. coli30-40 μM15-20 nmol/min/mgArgR repressor7.0-7.5
    Corynebacterium glutamicum250-300 μM5-10 nmol/min/mgLysG activator7.0-8.0
    Salmonella enterica20-30 μM10-15 nmol/min/mgArgR repressor6.5-7.0
    *Predicted values based on homology; experimental verification required
  • Regulatory differences:

    • Most Enterobacteriaceae utilize ArgR as the primary transcriptional regulator

    • Gram-positive bacteria often employ alternative regulatory mechanisms

    • Secondary regulation through global nitrogen regulators varies significantly between species

    • Post-translational regulation mechanisms (phosphorylation, acetylation) show species-specific patterns

  • Physiological roles:

    • Primary function in maintaining intracellular arginine homeostasis is conserved

    • Secondary roles in stress response, biofilm formation, and pathogenicity vary by species

    • Integration with other metabolic pathways shows species-specific adaptations

Understanding these comparative aspects provides context for interpreting experimental results with E. carotovora ArgO and may suggest targeted modifications to improve expression or functional characteristics.

What emerging technologies show promise for advancing ArgO research?

Several cutting-edge technologies are poised to accelerate research on membrane proteins like ArgO:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy (cryo-EM) with improved detectors enabling high-resolution structures of smaller membrane proteins

    • Microcrystal electron diffraction (MicroED) for structure determination from nanocrystals

    • Integrative structural biology combining multiple data sources through computational modeling

  • Novel membrane protein expression systems:

    • Cell-free expression systems optimized for membrane proteins

    • Synthetic minimal cells for specialized expression

    • Nanodiscs and other membrane mimetics for stabilization

    • ARGO (Analysis of Red-Green Offset) methodology for tracking protein turnover with high spatial and temporal resolution

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize membrane protein distribution and dynamics

    • Single-molecule tracking to analyze transport kinetics

    • Correlative light and electron microscopy for integrating functional and structural data

  • Innovative protein engineering approaches:

    • Computational design of stabilizing mutations

    • Directed evolution with deep mutational scanning

    • Chimeric proteins incorporating stable domains from thermophiles

  • Emerging analytical technologies:

    • Native mass spectrometry for membrane protein complexes

    • Nanopore-based single-molecule analysis of transport activity

    • Advanced cross-linking technologies like aromatic glyoxal cross-linkers (ArGOs) and lysine-arginine (KArGO) cross-linkers that provide complementary structural information to traditional approaches

  • Technology integration matrix:

    TechnologyApplication to ArgO ResearchReadiness LevelKey Advantages
    Cryo-EMHigh-resolution structure determinationImmediateNo crystallization required
    Cell-free expressionRapid production screeningImmediateToxic protein expression
    ARGO methodProtein turnover visualizationNear-termHigh spatial and temporal resolution
    ArGO/KArGO cross-linkingProtein interaction mappingImmediateComplementary to K-K crosslinking
    Computational designStability enhancementNear-termRational design approach
    Native MSOligomeric state determinationImmediatePreserves non-covalent interactions
    Deep mutational scanningFunction-structure relationshipsMedium-termComprehensive mutational analysis

These technologies offer complementary advantages and can be strategically combined to address specific research questions related to ArgO structure, function, and regulation.

What are the most promising applications of recombinant ArgO research?

Recombinant ArgO research opens several promising avenues for both basic and applied science:

  • Fundamental understanding of bacterial membrane transport:

    • Elucidation of arginine export mechanisms

    • Structure-function relationships in the LysE transporter family

    • Regulatory networks controlling amino acid homeostasis

  • Agricultural applications:

    • Development of targeted antimicrobials against E. carotovora

    • Engineering of resistance in host plants

    • Biocontrol strategies utilizing ArgO function

  • Biotechnological applications:

    • Engineered bacteria with enhanced arginine production capabilities

    • Designer probiotics with modified amino acid transport

    • Biosensors utilizing ArgO for arginine detection

  • Model system development:

    • ArgO as a prototype for membrane protein expression optimization

    • Template for rational design of transport proteins

    • Platform for studying membrane protein evolution

The convergence of advanced methodologies, including improved transformation techniques for E. carotovora , optimized fed-batch cultivation strategies , and innovative structural biology approaches such as arginine-selective cross-linking , positions ArgO research at the intersection of multiple scientific disciplines with significant potential for impactful discoveries.

What are the critical unresolved questions in ArgO research?

Despite advances in recombinant protein technologies, several critical questions remain unresolved in ArgO research:

  • Structural determinants of function:

    • Atomic-level structure of ArgO remains undetermined

    • Substrate binding site architecture is inferred but not confirmed

    • Conformational changes during transport cycle are poorly understood

    • Integration of transmembrane domains in the lipid bilayer requires characterization

  • Regulatory mechanisms:

    • Transcriptional control networks in E. carotovora require mapping

    • Post-translational modifications affecting ArgO activity are unexplored

    • Interaction partners modulating ArgO function remain to be identified

    • Stress-response pathways involving ArgO need characterization

  • Physiological roles:

    • Contribution to virulence in plant hosts is hypothesized but unconfirmed

    • Role in bacterial stress response requires quantification

    • Integration with other amino acid transport systems needs mapping

    • Impact on global cellular metabolism remains to be determined

  • Technical challenges:

    • Optimal expression conditions for functional protein require refinement

    • Reliable activity assays need standardization

    • Stabilization strategies for structural studies need development

    • In vivo monitoring of transport activity presents methodological challenges

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.