Recombinant Erwinia carotovora subsp. atroseptica ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us beforehand as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; ECA4518; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
atpB
Target Protein Sequence
MAAGEISTPQEYISHHLHHLQVGTGFWSINVDSMFFSIALGILFLVIFHRVAKRATSGVP GKLQTAVELLIGFVDGTVRDMFHGKSKLIAPLALTIFVWVFLMNMMDLLPIDLLPQLWAG VYSLLGYDPAHAYLRAVPTADVNITLSMALGVFILVLFYSIKMKGLGGFVKELTMQPFNH PVFIPINLILEGVSLLSKPISLGLRLFGNMYAGELIFILIAGLLPWWSQWLLNVPWAIFH ILIITLQAFIFMVLTVVYLSMASEEH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: eca:ECA4518

STRING: 218491.ECA4518

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpB) in Erwinia carotovora subsp. atroseptica?

ATP synthase subunit a (atpB) is a critical membrane-embedded component of the F0 sector of ATP synthase that forms part of the proton channel essential for ATP synthesis. In Erwinia carotovora subsp. atroseptica, as in other bacteria, this subunit contains multiple transmembrane helices that create the pathway for proton translocation across the membrane . The protein typically spans approximately 271-273 amino acids and contains 5-6 transmembrane domains that anchor it within the lipid bilayer .

The atpB subunit works in concert with the c-ring rotor, creating the structural elements necessary for converting the electrochemical gradient energy into mechanical rotation. This mechanical energy is then transferred to the F1 sector where ATP synthesis occurs . A highly conserved arginine residue in atpB plays a crucial role in proton translocation by interacting with the rotating c-ring subunits during catalysis.

Functionally, atpB is indispensable for energy metabolism in Erwinia carotovora subsp. atroseptica, as it enables the harvesting of energy from proton gradients to synthesize ATP, the primary energy currency of the cell . When properly assembled with other ATP synthase components, it contributes to the synthesis of approximately one million ATP molecules per minute per complex .

How similar is atpB from Erwinia carotovora subsp. atroseptica to homologous proteins from other bacterial species?

The ATP synthase subunit a shows significant conservation across bacterial species, reflecting its essential role in cellular energetics. Comparative sequence analysis reveals that atpB from Erwinia carotovora subsp. atroseptica shares approximately 85-90% sequence identity with its counterpart in Erwinia tasmaniensis . This high degree of conservation is particularly evident in the transmembrane domains and functional motifs involved in proton translocation.

Key conserved features include:

The amino acid sequence of Erwinia tasmaniensis ATP synthase subunit a contains 272 amino acids with characteristic hydrophobic regions corresponding to transmembrane domains . Similar structural organization would be expected in Erwinia carotovora subsp. atroseptica atpB, with most sequence variations occurring in loop regions or surface-exposed residues that don't directly participate in the proton translocation mechanism.

What detection and quantification methods are recommended for identifying recombinant atpB in expression systems?

For reliable detection and quantification of recombinant atpB, researchers should implement a multi-method approach:

SDS-PAGE analysis: Use 10-12% polyacrylamide gels with samples prepared in SDS loading buffer containing reducing agents (DTT or β-mercaptoethanol). Heating samples at 37°C rather than boiling can prevent aggregation of membrane proteins. Expected molecular weight for His-tagged atpB is approximately 30-32 kDa .

Western blotting:

  • Primary detection: Anti-His tag antibodies (1:3000 dilution) for tagged constructs

  • Secondary detection: Species-appropriate HRP-conjugated secondary antibodies (1:5000)

  • Alternative approach: Custom antibodies against conserved atpB epitopes for native protein detection

Mass spectrometry:

  • Sample preparation: In-gel tryptic digestion of SDS-PAGE bands

  • Analysis method: LC-MS/MS with database matching against Erwinia sequences

  • Confirmation: ≥3 unique peptides with >95% confidence for positive identification

Fluorescence methods:

  • GFP-fusion constructs to monitor expression in real-time

  • In-gel fluorescence to quantify properly folded protein

  • Fluorescence size-exclusion chromatography to assess aggregation state

Purity assessment typically involves densitometric analysis of SDS-PAGE gels, with >85% purity expected after optimized purification protocols. For absolute quantification, purified standards of known concentration should be included for calibration.

Which expression systems yield optimal results for recombinant Erwinia carotovora subsp. atroseptica atpB?

Based on experience with membrane proteins from Erwinia species, the following expression systems have proven effective:

Bacterial expression systems:

  • E. coli BL21(DE3) with pET vectors containing T7 promoters for high-level expression

  • E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

  • E. coli Lemo21(DE3) for tunable expression of potentially toxic membrane proteins

Mammalian cell lines:

  • HEK293 cells for complex structural studies requiring eukaryotic folding machinery

  • CHO cells for stable cell line development and larger-scale expression

Expression optimization parameters:

ParameterOptimal ConditionsRationale
Temperature16-20°CReduces inclusion body formation
Inducer concentration0.1-0.5 mM IPTGBalances expression level and toxicity
MediaTerrific Broth or autoinductionProvides nutrients for membrane synthesis
Additives0.5-1% glucoseSuppresses leaky expression
Induction timingOD600 0.6-0.8Ensures cells are in mid-log phase
Expression duration16-20 hoursAllows time for proper folding

Codon optimization for E. coli expression can significantly improve yields by addressing codon usage bias between Erwinia and E. coli. Additionally, fusion partners such as MBP or SUMO can enhance solubility and expression levels of challenging membrane proteins.

What purification methods provide the highest yield and purity for recombinant atpB?

A systematic purification approach is essential for obtaining high-quality recombinant atpB:

Membrane isolation and solubilization:

  • Harvest cells and resuspend in buffer (typically 50 mM Tris-HCl pH 8.0, 200 mM NaCl)

  • Lyse cells via sonication or high-pressure homogenization

  • Remove cell debris by low-speed centrifugation (10,000 × g, 20 min)

  • Collect membranes by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilize membranes in buffer containing appropriate detergent:

    • n-Dodecyl β-D-maltoside (DDM): 1% (w/v)

    • Lauryl maltose neopentyl glycol (LMNG): 0.5-1% (w/v)

    • Digitonin: 1-2% (w/v) for enhanced activity preservation

Chromatography sequence:

  • Immobilized metal affinity chromatography (IMAC):

    • Ni-NTA resin for His-tagged constructs

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 0.05% detergent, 20 mM imidazole

    • Wash buffer: Same as binding with 50 mM imidazole

    • Elution buffer: Same as binding with 250-300 mM imidazole

  • Size exclusion chromatography (SEC):

    • Column: Superdex 200 Increase 10/300 GL

    • Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDM or 0.01% LMNG

  • Optional ion exchange chromatography:

    • For additional purity when needed

    • Buffer system adjusted to pH where atpB has net charge (typically pH 6.5)

Typical yields range from 0.1–1.0 mg/mL post-reconstitution, with purity exceeding 85% as assessed by SDS-PAGE . For long-term storage, adding 50% glycerol and flash-freezing in liquid nitrogen has proven effective for similar membrane proteins from Erwinia species .

What strategies can overcome common challenges in atpB expression and purification?

Researchers frequently encounter specific challenges when working with membrane proteins like atpB:

Addressing low expression yields:

  • Optimize codon usage for the expression host

  • Reduce expression temperature to 16-18°C

  • Test different promoter strengths (T7, tac, arabinose-inducible)

  • Co-express with chaperones (GroEL/ES, DnaK/J)

  • Use specialized membrane protein expression strains (C41/C43)

Preventing aggregation during purification:

  • Maintain cold temperatures throughout purification (4°C)

  • Add stabilizing agents: glycerol (10%), cholesterol hemisuccinate (0.1%)

  • Include mild reducing agents: DTT (1 mM) or TCEP (0.5 mM)

  • Optimize detergent type and concentration

  • Use detergent mixtures (e.g., DDM with CHS or LMNG with GDN)

Enhancing protein stability:

  • Buffer optimization via thermal shift assays

  • Addition of specific lipids (POPC, POPE, cardiolipin)

  • Use of trehalose (6%) for lyophilization

  • Reconstitution into nanodiscs or amphipols

  • Single-use aliquots to avoid freeze-thaw cycles

Improving purity:

  • Two-step affinity tags (His-FLAG or His-Strep)

  • On-column detergent exchange

  • Gradient elution protocols

  • Size exclusion as final polishing step

For proteins showing particularly challenging behavior, cell-free expression systems can provide an alternative that bypasses issues related to membrane insertion and potential toxicity to the expression host.

What assays can be used to assess the functional integrity of purified recombinant atpB?

Functional characterization of atpB requires specialized assays that typically involve reconstitution with other ATP synthase components:

Proton translocation assays:

  • ACMA fluorescence quenching:

    • Reconstitute atpB with other F0 components in liposomes

    • Add ACMA (9-amino-6-chloro-2-methoxyacridine, 0.5 μM)

    • Initiate proton pumping with ATP (1 mM) + Mg2+ (2 mM)

    • Monitor fluorescence decrease (excitation 410 nm, emission 480 nm)

    • Validate with uncoupler (CCCP, 5 μM) to collapse gradient

  • Patch-clamp electrophysiology:

    • Reconstitute protein in giant unilamellar vesicles or planar lipid bilayers

    • Measure ion conductance under voltage clamp conditions

    • Characterize ion selectivity and gating properties

ATP synthesis assays:

  • Luciferase-based ATP detection:

    • Reconstitute complete ATP synthase in liposomes

    • Generate proton gradient (acid-base transition or valinomycin/K+)

    • Provide ADP (1 mM) and Pi (5 mM)

    • Measure ATP production using luciferase assay

    • Calculate rates from luminescence time course

  • 32P-labeled ADP incorporation:

    • Use [γ-32P]ADP as substrate

    • Measure incorporation of radioactive phosphate into ATP

    • Quantify by thin-layer chromatography or filter binding

Subunit interaction assays:

  • Co-purification experiments:

    • Co-express atpB with other ATP synthase subunits

    • Analyze co-purification by SDS-PAGE and Western blotting

    • Confirm specific interactions with detergent-resistant complexes

  • Surface plasmon resonance (SPR):

    • Immobilize purified atpB on sensor chip

    • Flow other subunits as analytes

    • Determine binding kinetics (kon, koff) and affinity (KD)

For atpB specifically, reconstitution into proteoliposomes with the correct lipid composition (POPC/POPE/cardiolipin) is critical for functional assessment, as the protein requires a membrane environment to maintain its native structure .

How do mutations in key residues of atpB affect ATP synthase function, and how should these experiments be designed?

Structure-function studies of atpB typically focus on conserved residues involved in proton translocation:

Critical residues for mutagenesis:

  • Conserved arginine (typically R210 based on E. coli numbering): Essential for proton translocation

  • Residues lining the proton channel: Usually include polar and charged amino acids

  • Interface residues with the c-ring: Often contain small side chains (glycine, alanine)

  • N-terminal and C-terminal regions: Important for assembly with other subunits

Experimental design for mutation studies:

Mutation TypeExpected EffectControl/Validation
R210A/KAbolishes proton translocationWild-type protein with same tag
Conservative substitutions (R→K)Reduced activityDemonstrate expression level equality
Cysteine scanningMap accessible residuesLabeling with sulfhydryl reagents
Charge reversalDisrupts electrostatic interactionsDouble reversal should restore function

Functional impact assessment:

  • Express wild-type and mutant proteins under identical conditions

  • Verify equal expression and purification yield by Western blot

  • Assess protein folding by circular dichroism or fluorescence spectroscopy

  • Measure proton translocation activity in reconstituted systems

  • Determine ATP synthesis rates for functional mutants

  • Analyze pH dependence to identify altered pKa values

  • Map mutations onto structural models to correlate structure with function

Controls and statistical considerations:

  • Include inactive control (heat-denatured protein)

  • Perform experiments with ≥3 biological replicates

  • Apply appropriate statistical tests (ANOVA with post-hoc analysis)

  • Consider complementation studies in ATP synthase-deficient strains

By systematically mapping the effects of mutations, researchers can create detailed functional maps of atpB and identify critical regions for inhibitor design or protein engineering .

What reconstitution methods provide the most reliable functional data for atpB studies?

Successful reconstitution of atpB requires careful attention to lipid composition, detergent removal, and protein orientation:

Lipid composition optimization:

  • POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine): 60-70%

  • POPE (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine): 20-30%

  • Cardiolipin: 5-10% (critical for ATP synthase function)

  • Additional components: Cholesterol (0-5%) for membrane stabilization

Reconstitution protocols:

  • Traditional liposome method:

    • Prepare lipids in chloroform, dry under nitrogen

    • Rehydrate with buffer (50 mM Tris-HCl pH 7.5, 10 mM MgCl2, 100 mM KCl)

    • Sonicate or extrude to form unilamellar vesicles

    • Add detergent-solubilized protein (protein:lipid ratio 1:50 to 1:100)

    • Remove detergent via:

      • Bio-Beads SM-2 adsorption (3 sequential additions, 4 hours each)

      • Dialysis (against detergent-free buffer, 3 changes, 48 hours)

      • Gel filtration (detergent below CMC)

  • Nanodisc reconstitution:

    • Mix lipids, membrane scaffold protein (MSP1D1), and atpB

    • Maintain molar ratio of MSP:lipid:protein at approximately 2:120:1

    • Remove detergent with Bio-Beads

    • Purify assembled nanodiscs by size exclusion chromatography

  • Proteoliposome catalytic activity assessment:

    • Verify protein incorporation by sucrose gradient flotation

    • Assess protein orientation using protease protection assays

    • Measure proton pumping using pH-sensitive fluorescent dyes

    • Determine ATP synthesis/hydrolysis rates under various conditions

For functional studies requiring the complete ATP synthase complex, co-reconstitution of atpB with other F0 subunits (particularly the c-ring) is essential, as is the addition of purified F1 sector components to assemble the holoenzyme .

What structural biology techniques are most effective for studying atpB, and how should experiments be designed?

Multiple complementary structural techniques can provide insights into atpB structure:

Cryo-electron microscopy (cryo-EM):

  • Most suitable for: Complete ATP synthase complex visualization

  • Sample requirements: 3-5 mg/mL protein, high purity (>90%)

  • Detergents: LMNG, GDN, or amphipols for enhanced particle distribution

  • Grid preparation: Thin ice (<100 nm) on holey carbon grids

  • Data collection: 300 kV microscope, direct electron detector

  • Analysis approach: Single particle analysis with 3D classification

X-ray crystallography:

  • Most suitable for: High-resolution structures of stable constructs

  • Crystallization strategies:

    • Lipidic cubic phase (monoolein-based mesophase)

    • Vapor diffusion with detergent screening matrix

    • Antibody fragment co-crystallization to increase polar contacts

  • Typical conditions: 20-30 mg/mL protein, 20°C, 2-4 weeks growth time

  • Diffraction collection: Synchrotron radiation with microfocus beamline

NMR spectroscopy:

  • Most suitable for: Dynamic regions, ligand binding studies

  • Sample preparation: 15N/13C-labeled protein in detergent micelles

  • Concentration: 0.5-1 mM for solution NMR

  • Analysis approaches: Backbone assignments, chemical shift perturbation

  • Specialized techniques: Solid-state NMR for membrane-embedded regions

Cross-linking mass spectrometry (XL-MS):

  • Most suitable for: Mapping interaction interfaces

  • Cross-linkers: MS-cleavable (e.g., DSSO), zero-length (EDC)

  • Workflow: Cross-linking → digestion → LC-MS/MS → data analysis

  • Validation: Comparison with available structures, distance constraints

Each technique provides complementary information, with cryo-EM increasingly becoming the method of choice for membrane protein complexes like ATP synthase due to advances in resolution and the ability to capture multiple conformational states.

How can researchers investigate the interaction between atpB and other ATP synthase subunits?

Several approaches can characterize the interactions between atpB and other ATP synthase components:

Biochemical interaction assays:

  • Co-immunoprecipitation (Co-IP):

    • Express atpB with epitope tag (FLAG, HA)

    • Solubilize membranes with mild detergents

    • Precipitate with antibody-conjugated beads

    • Analyze co-precipitating proteins by Western blot

    • Controls: Non-specific IgG, tag-only constructs

  • Pull-down assays:

    • Immobilize purified His-tagged atpB on Ni-NTA resin

    • Incubate with other subunits or cell lysates

    • Wash extensively to remove non-specific binding

    • Elute complexes and analyze by SDS-PAGE and mass spectrometry

Biophysical interaction methods:

  • Surface plasmon resonance (SPR):

    • Immobilize atpB on sensor chip via His-tag or biotinylation

    • Flow other subunits as analytes at multiple concentrations

    • Derive kinetic parameters (kon, koff) and equilibrium constants (KD)

    • Typical buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 0.05% DDM

  • Microscale thermophoresis (MST):

    • Label atpB with fluorescent dye or use GFP fusion

    • Titrate binding partner in 16-point dilution series

    • Measure thermophoretic movement to determine binding

    • Advantage: Works in complex solutions with minimal sample consumption

Structural approaches to interactions:

  • Cross-linking coupled with mass spectrometry:

    • Use bifunctional cross-linkers with different spacer lengths

    • Perform in purified complexes or membrane preparations

    • Identify cross-linked peptides by tandem mass spectrometry

    • Map interaction sites onto structural models

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Compare deuterium uptake of atpB alone vs. in complex

    • Identify protected regions indicative of interaction interfaces

    • Monitor conformational changes upon complex formation

These methods can reveal how atpB interacts with the c-ring in the F0 sector and with the peripheral stalk to ensure proper assembly and function of the ATP synthase complex .

What computational approaches complement experimental studies of atpB structure and function?

Computational methods provide valuable insights that extend experimental findings:

Homology modeling and structural prediction:

  • Template selection: Identify structures of homologous proteins (typically >30% sequence identity)

  • Modeling tools: SWISS-MODEL, I-TASSER, AlphaFold2

  • Refinement: Energy minimization in simulated membrane environment

  • Validation: Ramachandran analysis, QMEAN scores, ProSA z-scores

  • Output: Three-dimensional models showing transmembrane topology and key functional regions

Molecular dynamics simulations:

  • System preparation: Embed atpB model in lipid bilayer (POPC/POPE/cardiolipin)

  • Simulation parameters: 100-500 ns production runs, CHARMM36 or AMBER force fields

  • Analysis: Protein stability, lipid interactions, water accessibility

  • Advanced techniques: Steered MD for proton translocation pathway mapping

  • Hardware requirements: GPU clusters for adequate sampling

Protein-protein docking:

  • Rigid body docking: ZDOCK, ClusPro, HADDOCK

  • Flexible docking: Rosetta FlexPepDock, HADDOCK with defined flexible regions

  • Restraints: Incorporate experimental data (cross-linking, mutagenesis)

  • Scoring: Evaluate interface energy, buried surface area, evolutionary conservation

  • Validation: Compare with low-resolution experimental structures

Sequence-based analysis:

  • Conservation mapping: ConSurf, Evolutionary Trace

  • Coevolution analysis: Direct Coupling Analysis (DCA), GREMLIN

  • Transmembrane topology prediction: TMHMM, Phobius

  • Disorder prediction: DISOPRED, IUPred

  • Functional site prediction: 3DLigandSite, COACH

For atpB specifically, computational studies can identify the proton pathway through the protein, predict interactions with the c-ring, and suggest key residues for targeted mutagenesis . Integration of computational predictions with experimental validation creates a powerful approach for understanding this complex membrane protein.

How can atpB be used as a target for developing new antimicrobials against plant pathogens?

ATP synthase has emerged as a promising antimicrobial target, and atpB specifically offers several advantages:

Target validation considerations:

  • Essential for energy metabolism in Erwinia species

  • Structural differences from plant ATP synthases

  • Previous success with ATP synthase inhibitors in other bacteria

  • Potential for species-selective targeting due to sequence differences

Inhibitor discovery approaches:

  • Structure-based virtual screening:

    • Generate homology model of Erwinia atpB

    • Identify binding pockets, focusing on the proton channel

    • Screen compound libraries (>1 million compounds)

    • Filter hits by predicted binding energy and drug-likeness

    • Experimental validation of top 100-200 candidates

  • Fragment-based lead discovery:

    • Screen fragment libraries (1000-2000 compounds)

    • Identify binding fragments by SPR, thermal shift assays, or NMR

    • Link or grow fragments to improve potency

    • Structure-guided optimization

  • Peptide inhibitor development:

    • Design peptides mimicking interface regions

    • Test competitive inhibition of subunit assembly

    • Enhance stability with non-natural amino acids

    • Improve membrane permeability with cell-penetrating sequences

Assay development for inhibitor screening:

  • ATP synthesis inhibition in inverted membrane vesicles

  • Proton translocation assays in reconstituted systems

  • Thermal shift assays for direct binding

  • Growth inhibition of Erwinia species

Target product profile for atpB inhibitors:

  • MIC <10 μg/mL against Erwinia carotovora

  • 10-fold selectivity over beneficial bacteria and plant cells

  • Stability in agricultural use conditions

  • Compatibility with integrated pest management

This research direction leverages the critical role of ATP synthase in bacterial energy metabolism while exploiting structural differences to achieve selectivity against plant pathogens .

What experimental designs are most effective for investigating the role of atpB in bacterial stress responses?

ATP synthase functions not only in energy production but also in stress adaptation:

Experimental approaches to stress response studies:

  • Gene expression analysis under stress conditions:

    • Expose bacteria to relevant stresses (pH, temperature, oxidative, osmotic)

    • Extract RNA at multiple time points (15, 30, 60, 120 minutes)

    • Perform qRT-PCR or RNA-seq to quantify atpB expression changes

    • Compare with known stress response genes

    • Analyze promoter elements for stress-responsive transcription factors

  • Protein-level stress response:

    • Generate reporter fusions (atpB-GFP) to track protein levels

    • Use pulse-chase experiments to measure protein turnover

    • Perform Western blots with phospho-specific antibodies to detect post-translational modifications

    • Analyze protein-protein interactions under stress conditions

  • Phenotypic characterization of atpB mutants under stress:

    • Create point mutations in key residues

    • Generate conditional knockdown strains

    • Assess growth curves under various stress conditions

    • Measure ATP levels, membrane potential, and pH homeostasis

    • Evaluate survival after stress exposure

  • In vivo functional studies:

    • Plant infection models with wild-type and mutant strains

    • Competitive index assays to measure fitness

    • Microscopy to track bacterial localization during infection

    • Metabolomic analysis to identify stress-related metabolites

Recent findings with Erwinia species suggest that ATP synthase gene expression may be regulated by the PhoPQ two-component system, indicating potential integration with stress response pathways . Additionally, the superoxide dismutase gene (sodC) has been found to be co-regulated with some ATP synthase components, suggesting a link between energy metabolism and oxidative stress response .

How can researchers utilize recombinant atpB to study evolutionary adaptations in Erwinia species?

Evolutionary studies of atpB can provide insights into bacterial adaptation and speciation:

Comparative genomic approaches:

  • Sequence collection and alignment:

    • Gather atpB sequences from multiple Erwinia species/strains

    • Include closely related genera (Pantoea, Pectobacterium)

    • Align sequences using MUSCLE or T-Coffee

    • Identify conserved domains and variable regions

  • Phylogenetic analysis:

    • Construct trees using Maximum Likelihood or Bayesian methods

    • Compare atpB-based trees with whole-genome phylogenies

    • Identify potential horizontal gene transfer events

    • Calculate selection pressure (dN/dS ratios) on different domains

  • Ancestral sequence reconstruction:

    • Infer ancestral atpB sequences at key evolutionary nodes

    • Express and characterize reconstructed proteins

    • Compare biochemical properties with extant proteins

    • Map functional changes to specific amino acid substitutions

Experimental evolution studies:

  • Laboratory evolution under selective pressure:

    • Grow Erwinia strains under various conditions (pH, temperature, antibiotics)

    • Sequence atpB after multiple generations

    • Identify and characterize adaptive mutations

    • Reconstitute mutations in recombinant protein for functional analysis

  • Host adaptation studies:

    • Compare atpB sequences from strains isolated from different plant hosts

    • Identify host-specific sequence patterns

    • Test recombinant proteins with sequences from different hosts

    • Correlate biochemical properties with host preference

Structure-function correlation in evolution:

  • Conservation mapping:

    • Project sequence conservation onto structural models

    • Identify highly conserved vs. variable regions

    • Correlate conservation patterns with functional domains

    • Predict coevolving residue networks

  • Comparative biochemistry:

    • Express recombinant atpB from multiple Erwinia species

    • Compare enzymatic parameters (KM, Vmax, pH optima)

    • Assess thermal stability and detergent compatibility

    • Measure proton translocation efficiency

These approaches can reveal how atpB has evolved within the Erwinia genus to adapt to different ecological niches and plant hosts, providing insights into speciation and host-pathogen coevolution .

What are the most common problems encountered when working with recombinant atpB, and how can they be resolved?

Researchers frequently encounter specific challenges with membrane proteins like atpB:

Expression challenges:

ProblemPotential CausesSolutions
Low expression yieldToxicity to host cellsUse C41/C43 strains, reduce temperature to 16°C
Plasmid instabilityReduce IPTG concentration, use glucose to suppress leaky expression
Codon biasOptimize codons for expression host
Inclusion body formationRapid expression rateLower induction temperature, use weaker promoter
Inefficient membrane insertionCo-express with membrane insertion machinery (YidC)
Protein degradationProtease activityAdd protease inhibitors, use BL21(DE3) pLysS strain

Purification difficulties:

ProblemPotential CausesSolutions
Poor solubilizationIneffective detergentScreen detergent panel (DDM, LMNG, digitonin)
Inadequate detergent concentrationOptimize detergent:protein ratio
Protein aggregationDetergent removal during concentrationAdd fresh detergent, use cutoff concentrators
Lipid depletionSupplement with POPC/POPE mixture
Low purityNon-specific binding to resinIncrease imidazole in wash buffer (40-50 mM)
Interacting proteinsUse tandem purification (His + second tag)

Functional reconstitution issues:

ProblemPotential CausesSolutions
No proton translocationImproper orientation in liposomesTry freeze-thaw cycles, pH gradients during reconstitution
Denatured proteinCheck secondary structure by CD spectroscopy
Missing essential lipidsAdd cardiolipin (5-10%) to reconstitution mixture
Poor assembly with F1Buffer incompatibilityOptimize pH and ionic strength for complex formation
Incorrect stoichiometryAdjust protein ratios based on SDS-PAGE quantification

Storage and stability problems:

ProblemPotential CausesSolutions
Activity loss during storageFreeze-thaw damagePrepare single-use aliquots
Detergent precipitationStore above detergent cloud point
OxidationAdd reducing agent (1 mM DTT or TCEP)
Precipitation during thawingProtein aggregationThaw quickly at 25°C, gentle mixing
Detergent crystallizationWarm buffer before adding to frozen protein

Many of these challenges can be addressed through systematic optimization of conditions and the inclusion of appropriate stabilizing agents like trehalose for lyophilized preparations .

What quality control measures should be implemented throughout the atpB research workflow?

Rigorous quality control is essential for reliable research with recombinant atpB:

Expression quality control:

  • Small-scale expression tests before scaling up

  • SDS-PAGE and Western blot to confirm target protein identity

  • Growth curve monitoring to detect toxicity effects

  • Confirmation of plasmid sequence before and after expression

  • Inclusion of positive control protein (e.g., GFP fusion) in parallel

Purification quality control:

  • Purity assessment:

    • SDS-PAGE with densitometry (>85% purity target)

    • Silver staining for detection of minor contaminants

    • Mass spectrometry for protein identification confirmation

    • Size exclusion chromatography profile analysis

  • Structural integrity:

    • Circular dichroism to confirm secondary structure (alpha-helical for atpB)

    • Fluorescence spectroscopy to assess tertiary structure

    • Thermal stability assays to determine melting temperature

    • Limited proteolysis to detect properly folded domains

Functional quality control:

  • Activity benchmarks:

    • Establish standard activity measurements for batch comparison

    • Use known inhibitors (oligomycin, DCCD) as controls

    • Compare activity with published values for similar proteins

    • Include positive control (e.g., E. coli ATP synthase) when possible

  • Specificity controls:

    • Inactive mutant (R210A) as negative control

    • Heat-denatured protein control

    • Buffer-only reconstitution control

    • Substrate specificity tests (ATP vs. GTP)

Storage stability monitoring:

  • Activity testing after various storage durations

  • Freeze-thaw stability assessment

  • Accelerated stability testing at different temperatures

  • Visual inspection for aggregation or precipitation

A systematic quality control process ensures that experimental results reflect the true properties of atpB rather than artifacts from preparation or handling .

What considerations are critical when designing experiments to compare wild-type and mutant atpB variants?

Comparative studies between wild-type and mutant atpB require careful experimental design:

Expression and purification consistency:

  • Express all variants in parallel under identical conditions

  • Use the same purification protocol for all variants

  • Quantify protein concentration by multiple methods (Bradford, BCA, A280)

  • Assess purity by SDS-PAGE with densitometry to ensure comparable purity

  • Document and control for any differences in yield or behavior

Structural characterization comparisons:

  • Perform CD spectroscopy on all variants to detect secondary structure changes

  • Use thermal shift assays to compare stability

  • Apply limited proteolysis to identify structural differences

  • Consider native PAGE to assess oligomeric state consistency

Functional comparison framework:

  • Test activity under multiple conditions (pH range, temperature range)

  • Determine complete kinetic parameters (KM, Vmax) rather than single-point measurements

  • Measure activity at several protein concentrations to ensure linearity

  • Include appropriate controls for each variant (heat-inactivated controls)

Statistical considerations:

  • Perform experiments with at least three biological replicates

  • Include technical replicates (minimum of three)

  • Apply appropriate statistical tests:

    • t-test for comparing two variants

    • ANOVA with post-hoc tests for multiple variants

    • Non-parametric alternatives if data doesn't meet assumptions

  • Report effect sizes along with p-values

  • Consider power analysis to determine appropriate sample sizes

Data presentation guidelines:

  • Use consistent axes and scales when plotting multiple variants

  • Include error bars representing standard deviation or standard error

  • Show individual data points when possible

  • Use color schemes accessible to colorblind individuals

This rigorous approach ensures that observed differences between variants can be confidently attributed to the specific mutations rather than experimental variables or artifacts .

What are the emerging trends in atpB research and how might they shape future studies?

Recent developments in ATP synthase research point to several promising directions:

Advanced structural determination:

  • Cryo-EM is revolutionizing our understanding of ATP synthase structure, with resolutions now approaching 2.5-3Å for bacterial complexes

  • Time-resolved methods are beginning to capture different conformational states during the catalytic cycle

  • Integrative structural biology approaches combining multiple techniques provide more complete structural models

Novel functional insights:

  • Beyond ATP synthesis, ATP synthase is increasingly recognized for roles in pH homeostasis and membrane potential maintenance

  • Connection between ATP synthase function and bacterial pathogenesis is emerging as an important research area

  • Regulatory mechanisms controlling ATP synthase activity in response to environmental conditions are being elucidated

Technological advances:

  • Nanodiscs and other membrane mimetics are improving the stability and homogeneity of reconstituted samples

  • Single-molecule techniques are providing unprecedented insights into ATP synthase rotation mechanics

  • Genome editing tools enable more precise in vivo studies of ATP synthase function

Translational applications:

  • ATP synthase is gaining attention as an antimicrobial target, with several inhibitors in development

  • Synthetic biology approaches are exploring ATP synthase engineering for improved efficiency or novel functions

  • Connections between ATP synthase and bacterial virulence open new approaches to plant disease control

Future studies are likely to focus on integrating structural, functional, and evolutionary data to develop comprehensive models of ATP synthase function in different bacterial species, including plant pathogens like Erwinia carotovora subsp. atroseptica .

How can researchers integrate atpB studies with broader investigations of bacterial metabolism and pathogenesis?

ATP synthase functions within a complex network of cellular processes:

Integration with metabolic studies:

  • Combine ATP synthase functional assays with metabolomic profiling

  • Trace isotope-labeled carbon flow through central metabolism to ATP synthesis

  • Develop mathematical models connecting electron transport chain function to ATP production

  • Investigate the effects of environmental conditions on ATP homeostasis

Connection to virulence mechanisms:

  • Examine atpB expression patterns during different infection stages

  • Create conditional atpB mutants to assess impact on virulence factor production

  • Investigate links between energy metabolism and secretion system function

  • Study how host defense responses affect bacterial ATP synthesis

Systems biology approaches:

  • Construct protein-protein interaction networks centered on ATP synthase

  • Perform transcriptomic analysis under conditions relevant to infection

  • Use flux balance analysis to predict metabolic adaptations involving ATP synthase

  • Develop multi-scale models connecting molecular mechanisms to cellular phenotypes

Temporal and spatial considerations:

  • Track ATP levels in bacteria during infection using fluorescent reporters

  • Map ATP synthase localization in bacterial cells during different growth phases

  • Investigate potential microdomains for ATP production within bacterial membranes

  • Study temporal dynamics of ATP synthase assembly and disassembly

Research in Erwinia species has already begun connecting ATP synthase function to virulence, with evidence that the PhoPQ two-component system, which regulates virulence factors, also influences energy metabolism genes . This integrative approach provides a more comprehensive understanding of how fundamental processes like ATP synthesis contribute to bacterial fitness and pathogenesis.

What new methodologies or technologies are likely to advance atpB research in the coming years?

Several emerging technologies hold promise for advancing atpB research:

Advanced imaging techniques:

  • Cryo-electron tomography to visualize ATP synthase in situ within bacterial membranes

  • Super-resolution fluorescence microscopy for tracking ATP synthase dynamics in living cells

  • Time-resolved cryo-EM to capture conformational changes during the catalytic cycle

  • Correlative light and electron microscopy to connect function with structure

Innovative protein engineering approaches:

  • Unnatural amino acid incorporation to introduce specific probes or cross-linkers

  • Split fluorescent protein systems to monitor protein-protein interactions in vivo

  • Optogenetic tools to control ATP synthase activity with light

  • Directed evolution strategies to develop modified ATP synthases with enhanced properties

Enhanced functional assays:

  • Microfluidic devices for high-throughput activity screening

  • Single-molecule FRET to monitor conformational changes during catalysis

  • Nanopore-based techniques to study proton translocation in real-time

  • Genetically encoded ATP sensors with improved sensitivity and specificity

Computational advances:

  • Machine learning approaches for structure prediction and functional annotation

  • Enhanced molecular dynamics simulations with improved force fields for membrane proteins

  • Quantum mechanics/molecular mechanics (QM/MM) methods for studying proton transfer

  • Network analysis tools to map evolutionary relationships and coevolutionary patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.