Recombinant Erwinia carotovora subsp. atroseptica Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
aas; ECA3641; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-738
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
aas
Target Protein Sequence
MIHTLLRWVFQRLYRIRIEGDSSQFQQSKLLITPNHVSFLDGVLLALFLPIKPVFAVYSS ISDRWFMRWLKPYIDFVPLDPTKPLAIKGLIKVIERGQPVVVFPEGRISVTGSLMKVYSG AAFVAAKSGATIIPVRIDGIELSPFGRLAGVFKRRCLPQVTITYLPPTTLPMPEASSARA RRALAGERLHQIMMKARMETRPQHTLYQAFLAARSRYGRHSASIADISFNEDSYQGLLKK SLGVSRILQRFTRADEHVGMLLPNATITAASILGASLRNRIPAMLNYTAGAKGLQSAMKA AGIKTIVTSRQFLEKGKLTDLPKQVSEANWVYLEDLKDTVTLKDKLWILFHLLFPARAML PQKPDDAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVADFTPGDRFMSALPLFHAFG LTVGLLTPLITGARVFLYPSPLHYRIVPELVYDQNCTVLFGTSTFLGNYARFAHPYDFAR LRYVVAGAEKLSETTRQVWQDKFGIRILEGYGVTECAPVVAINVPMATKIHSVGLLLPEM ESRLITVPGITRGGRLQLRGPNIMKGYLRVENPGVLETPAAENAEGELQQGWYDTGDIVE LDERGFCTIIGRVKRFAKLAGEMVSLESVEQLAVKVSPEAQHAASAKSDSSKGEALVLFT TDSQITRDVLLAQARSSGVPELAVPRDIRYVKALPLLGSGKPDFVTLRQMAEEPNSEQSV IEPSIVKQPITNASEPSA
Uniprot No.

Target Background

Function

This bifunctional protein plays a crucial role in lysophospholipid acylation. It transfers fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its primary physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links

KEGG: eca:ECA3641

STRING: 218491.ECA3641

Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Structural and Functional Characteristics

Q: What is the bifunctional protein aas from Erwinia carotovora subsp. atroseptica and what are its primary functions?

A: The bifunctional protein aas (UniProt ID: Q6D107) from Erwinia carotovora subsp. atroseptica (also known as Pectobacterium atrosepticum) is a multi-domain protein that primarily functions in phospholipid metabolism. This protein encompasses two major functional domains: 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40) and acyl-[acyl-carrier-protein]--phospholipid acyltransferase. The protein plays a critical role in membrane phospholipid remodeling and fatty acid incorporation into membrane structures. The full protein consists of 738 amino acids with a specific sequence starting with MIHTLLRWVFQR and contains several conserved catalytic regions for substrate binding and enzymatic activity .

Q: How does the aas protein differ from other well-studied proteins in Erwinia species?

A: The aas protein from E. carotovora subsp. atroseptica differs significantly from other well-characterized Erwinia proteins such as L-asparaginase. While L-asparaginase from related Erwinia species (like E. carotovora) has been extensively studied for its therapeutic potential in treating acute lymphoblastic leukemia due to its ability to hydrolyze L-asparagine to aspartic acid, the bifunctional aas protein serves primarily in bacterial membrane phospholipid metabolism . Unlike L-asparaginase, which is often secreted and has clinical applications, aas functions intracellularly in phospholipid remodeling and has not been developed for therapeutic purposes. Additionally, while L-asparaginase demonstrates reasonably high thermodynamic stability with therapeutic potential despite some limitations, the bifunctional nature of aas reflects its specialized role in bacterial cell membrane maintenance rather than as an extracellular enzyme .

Expression and Purification

Q: What are the optimal conditions for expressing recombinant Erwinia carotovora subsp. atroseptica Bifunctional protein aas?

A: Based on related recombinant protein expression studies with Erwinia proteins, optimal expression of the bifunctional protein aas typically employs E. coli BL21(DE3) as the expression host with pET vector systems (such as pET21a+) . Expression optimization involves several key parameters:

The optimization process should include careful consideration of the signal peptide removal, as the first 21 N-terminal amino acids may function as a leader sequence that could affect proper folding and activity when expressed recombinantly .

Functional Characterization and Assays

Q: What are the most reliable assays for measuring both functional activities of the bifunctional aas protein, and how can activity be optimized?

A: For comprehensive functional characterization of the bifunctional aas protein, researchers should employ distinct assays targeting each of its enzymatic domains:

For the 2-acylglycerophosphoethanolamine acyltransferase activity:

  • Radiometric assay using 14C-labeled acyl-CoA donors and measuring incorporation into phospholipid fractions

  • HPLC-based assay monitoring the conversion of substrate to product using specific phospholipid separation columns

  • Coupled enzyme assay measuring CoA release during the acyltransferase reaction

Activity optimization protocols should account for:

  • pH optimization (typically between 7.0-8.5)

  • Divalent cation requirements (Mg2+ or Mn2+ at 1-5 mM concentrations)

  • Substrate concentration optimization with Michaelis-Menten kinetics analysis

  • Temperature stability profile (typically 25-37°C for maximum activity retention)

Each assay should include appropriate controls including heat-inactivated enzyme and reaction mixtures lacking critical components to ensure specificity of the measured activity. When analyzing kinetic parameters, it's essential to ensure that the enzyme concentration is within the linear response range for accurate determination of initial velocity conditions .

Structural Analysis and Protein Engineering

Q: What structural features of the aas protein are critical for its bifunctional activity, and how might targeted mutations affect its function?

A: The bifunctional protein aas contains several structural elements critical for its dual functionality:

  • N-terminal domain (approximately residues 1-350): Contains the acyltransferase active site with conserved catalytic residues

  • Central domain (approximately residues 351-550): Contains substrate binding regions and critical interface regions between the two functional domains

  • C-terminal domain (approximately residues 551-738): Houses the second catalytic function with distinct substrate specificity

Key structural features that would be targets for protein engineering include:

  • Conserved motifs within the amino acid sequence that may be involved in substrate binding

  • Interface regions between the two functional domains that could affect allosteric regulation

  • Specific residues within the active sites that determine substrate specificity

Based on analogous studies with other bifunctional enzymes, mutations in the interface regions between domains often affect the communication between the two activities, potentially uncoupling them or altering their regulatory relationship. Targeted mutations in substrate binding pockets could potentially alter substrate specificity or catalytic efficiency. A systematic mutagenesis approach focusing on conserved residues within each catalytic domain would provide valuable insights into structure-function relationships .

Experimental Design Considerations

Q: How should researchers design experiments to investigate potential interactions between the aas protein and the pathogenicity mechanisms of Erwinia carotovora?

A: To investigate the relationship between the bifunctional aas protein and pathogenicity mechanisms of Erwinia carotovora subsp. atroseptica, researchers should implement a multi-faceted experimental approach:

  • Gene knockout/complementation studies:

    • Generate aas gene deletion mutants in E. carotovora subsp. atroseptica

    • Assess virulence in plant infection models (particularly potato tubers)

    • Complement with wild-type and mutant variants to confirm specificity

  • Transcriptomic/proteomic analysis:

    • Compare gene/protein expression profiles between wild-type and aas mutants

    • Identify co-regulated pathways during infection

    • Perform time-course analysis during different infection stages

  • Lipid profile analysis:

    • Characterize membrane phospholipid composition changes in wild-type vs. mutants

    • Correlate membrane composition with virulence factors secretion

  • Host-pathogen interaction studies:

    • Investigate whether membrane composition affects protein secretion systems

    • Test if aas activity influences bacterial resistance to host defense mechanisms

This experimental design should incorporate appropriate controls, including testing multiple bacterial strains with different levels of pathogenicity, as observed with other E. carotovora isolates that demonstrate variable virulence toward plant hosts . The Picasso potato variety has shown high sensitivity to E. carotovora infection and would be an appropriate model system for these studies .

Protein Stability and Storage

Q: What are the optimal storage conditions for maintaining long-term stability of purified recombinant aas protein, and how can researchers monitor activity loss?

A: Based on related recombinant proteins from Erwinia species, the following storage protocol is recommended for maintaining optimal stability of the bifunctional aas protein:

Storage ParameterRecommended ConditionsPurpose
Buffer composition50 mM Tris-HCl, pH 8.0-8.6 with 50% glycerolStabilizes protein structure and prevents freeze-thaw damage
Temperature-20°C (short-term), -80°C (long-term)Minimizes degradation and activity loss
AliquotingSmall single-use volumesPrevents repeated freeze-thaw cycles
Working stocksStore at 4°C for maximum 1 weekMaintains activity for routine experiments
Stabilizing additivesConsider 1-5 mM DTT or β-mercaptoethanolProtects potential sensitive thiol groups

To monitor activity loss over time, researchers should:

  • Establish a baseline activity measurement immediately after purification

  • Periodically test aliquots from the same preparation under identical assay conditions

  • Plot activity retention as a function of time under different storage conditions

  • Perform regular protein integrity checks via SDS-PAGE to detect potential degradation

Erwinia proteins typically show variable stability profiles, with some demonstrating rapid inactivation in the presence of denaturants like urea, suggesting careful handling is required . Unlike some bacterial enzymes with high thermodynamic stability, Erwinia-derived proteins often benefit from storage with cryoprotectants and minimal exposure to freeze-thaw cycles .

Purification Optimization

Q: What purification strategy yields the highest specific activity for recombinant aas protein, and how can researchers troubleshoot common purification problems?

A: A multi-step purification strategy optimized for recombinant aas protein typically includes:

  • Initial clarification:

    • Cell harvest by centrifugation (8,000 rpm, 4°C, 5 minutes)

    • Resuspension in Tris-HCl buffer (pH 8.6)

    • Sonication and centrifugation (12,000 rpm, 4°C, 15 minutes)

  • Primary purification:

    • Ammonium sulfate fractionation (typically 30-60% saturation)

    • Hydrophobic interaction chromatography using Phenyl Sepharose

  • Fine purification:

    • Ion exchange chromatography (DEAE or Q Sepharose)

    • Gel filtration chromatography for final polishing

Common purification problems and troubleshooting approaches:

ProblemPotential CauseTroubleshooting Approach
Low yieldPoor expressionOptimize induction parameters; check for proper codon usage
Low activityImproper foldingAdjust lysis conditions; try different buffer systems
Protein aggregationImproper buffer conditionsAdd stabilizing agents; optimize pH and salt concentration
Copurifying contaminantsInadequate separationAdd additional chromatography steps; try different column matrices
Proteolytic degradationProtease activityAdd protease inhibitors; reduce purification time; maintain cold temperatures

For assessing purification efficiency, calculate specific activity (units/mg protein) at each step and determine fold purification and percent recovery. A typical purification table should track total protein, total activity, specific activity, yield percentage, and purification fold across all steps .

Cross-Species Analysis

Q: How does the bifunctional aas protein from E. carotovora subsp. atroseptica compare with homologous proteins from other bacterial species in terms of structure and function?

A: The bifunctional aas protein shows interesting evolutionary relationships and functional conservation across bacterial species:

Cross-species functional analysis reveals that while the core catalytic mechanism is typically conserved, bacterial adaptation to different ecological niches has driven variations in substrate specificity and domain organization. Unlike the L-asparaginase enzyme, which shows significant variations in glutaminase activity and stability across bacterial species (with E. carotovora L-asparaginase showing 30 times lower toxicity than E. coli enzyme in leukemia cell lines ), the bifunctional aas protein tends to maintain its core phospholipid remodeling functions across species, with variations mostly in catalytic efficiency and thermal stability.

Researchers investigating the evolutionary aspects of aas proteins should consider performing phylogenetic analysis combined with structural modeling to identify conserved catalytic residues versus species-specific adaptations .

Emerging Applications

Q: What are promising new research applications for the bifunctional aas protein beyond its basic characterization?

A: Emerging research directions for the bifunctional aas protein include:

  • Synthetic biology applications:

    • Engineering bacterial membrane composition through aas protein modifications

    • Creating custom lipid profiles for biotechnological applications

    • Developing biosensors based on membrane composition changes

  • Bacterial physiology studies:

    • Investigating the role of phospholipid remodeling in stress responses

    • Exploring connections between membrane composition and antibiotic resistance

    • Understanding the impact of environmental conditions on membrane remodeling

  • Plant-pathogen interaction mechanisms:

    • Determining if aas activity influences plant defense recognition

    • Exploring whether membrane composition affects type III secretion system function

    • Developing targeted inhibitors of aas as potential antimicrobial agents

  • Structural biology advancements:

    • Resolving the crystal structure of the complete bifunctional protein

    • Performing molecular dynamics simulations to understand interdomain communications

    • Mapping the conformational changes during catalysis

These research directions build upon understanding that bacterial proteins like L-asparaginase from related Erwinia species have demonstrated significant research applications beyond their native function, such as in treatment of acute childhood lymphoblastic leukemia . Similarly, the aas protein may offer novel applications in biotechnology and bacterial physiology studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.