Recombinant Erwinia carotovora subsp. atroseptica Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
clsA; cls; ECA2318; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
clsA
Target Protein Sequence
MSTFYTVISWLLVFSYWLLIAGVTLRILMKRRAVPSAMAWLLVIYILPLVGIVAYLSFGE LHLGKRRAERASKMWPSTAKWLRELKEYRRIFATENSEVASALFQLCERRQGVGGVKGNQ LQLMTTFDDTIKALLRDIELARNNIEMVFYIWQPGGLVEQVTSSLISAARRGVHCRILLD SAGSVQFFRQHHPELMRTAGIEVVEALKVNLFRAFLRRMDLRQHRKIILIDSRIAYTGSM NMVDPRLFKQDAGVGQWIDLMARIEGPVATTLGIIYCCDWEMETGKRLLPPPPDVNVMPF EQESGHTIQVIASGPGYPEEMIHQALLTSVYSARKQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPHKNDSVLVGWASRAFFTELLAAGVKIYQFKDGLLHTKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDAGFGSDLACVQEDYIARSRLLNATQWQNRPYWQRIVERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: eca:ECA2318

STRING: 218491.ECA2318

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what is its role in bacterial physiology?

Cardiolipin synthase (Cls) is an essential enzyme that catalyzes the final step in cardiolipin biosynthesis. In bacteria like Erwinia carotovora subsp. atroseptica, cardiolipin is a four-chained anionic membrane phospholipid composed of two phosphatidyl moieties joined by a glycerol link . It plays critical roles in:

  • Maintaining bacterial membrane integrity and stability

  • Energy production through interaction with respiratory complexes

  • Stress response mechanisms

The bacterial-type cardiolipin synthase primarily catalyzes the transfer of the phosphatidyl moiety of phosphatidylglycerol to a second molecule of phosphatidylglycerol, forming cardiolipin and releasing glycerol . This mechanism differs from eukaryotic cardiolipin synthesis, which uses CDP-diacylglycerol as a phosphatidyl donor to phosphatidylglycerol .

How is cardiolipin structured and distributed in bacterial membranes?

Cardiolipin (1,3-bis(sn-3'-phosphatidyl)-sn-glycerol) has a unique dimeric structure containing four acyl chains and two phosphate groups . In bacteria:

  • Cardiolipin is primarily localized in bacterial membranes, comprising approximately 5-15% of total phospholipids depending on growth conditions and phase

  • It has a conical molecular shape that contributes to membrane curvature

  • It tends to concentrate at the poles and division sites of bacterial cells

  • It forms microdomains that are important for the localization and function of membrane proteins

The unique structure of cardiolipin allows it to serve as a proton trap within membranes, thereby strictly localizing the proton pool and minimizing pH changes during oxidative phosphorylation .

What biosynthetic pathways exist for cardiolipin production in prokaryotes?

Research has identified three distinct mechanisms for cardiolipin synthesis in prokaryotes:

  • Classical bacterial pathway (ClsA/ClsB): Condenses two phosphatidylglycerol (PG) molecules to form cardiolipin and glycerol

  • Phosphatidylethanolamine-dependent pathway (ClsC): Uses phosphatidylethanolamine (PE) as the phosphatidyl donor to PG to form cardiolipin, as discovered in E. coli

  • Eukaryotic-like pathway: Some bacteria may possess CDP-diacylglycerol-dependent cardiolipin synthases similar to those found in eukaryotes

The presence of multiple pathways provides redundancy, explaining why cls mutants in some bacteria still contain residual cardiolipin levels. For example, E. coli contains three cardiolipin synthases (ClsA, ClsB, and ClsC), and only the triple mutant completely lacks detectable cardiolipin .

What methodologies are most effective for analyzing cardiolipin synthase activity in vitro?

For robust in vitro analysis of recombinant Erwinia carotovora subsp. atroseptica cardiolipin synthase activity, researchers should consider:

Enzyme Preparation:

  • Express recombinant protein with appropriate tags that don't interfere with activity

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Maintain in stabilizing buffer containing glycerol (typically 50% as used in commercial preparations)

Activity Assays:

  • Radioactive Substrate Incorporation:

    • Incubate enzyme with radiolabeled substrates ([³²P]phosphatidylglycerol)

    • Extract lipids and separate by thin-layer chromatography

    • Quantify radioactivity in cardiolipin spots

  • Mass Spectrometry-Based Assays:

    • Use synthetic phospholipids with unique fatty acyl moieties (different chain lengths)

    • Analyze reaction products using collision-induced dissociation dual MS

    • This approach was successfully used to characterize the unusual ClsC enzyme in E. coli

  • Fluorescence-Based Assays:

    • Use fluorescently labeled phospholipid substrates

    • Monitor changes in fluorescence intensity or anisotropy

Critical Parameters to Control:

  • pH (typically 7.0-8.0)

  • Ionic strength

  • Divalent cation concentration (Mg²⁺ or Mn²⁺)

  • Temperature (30-37°C)

  • Detergent/lipid ratio for optimal enzyme activity

How does cardiolipin composition affect bacterial stress response and adaptation?

Cardiolipin plays a critical role in bacterial stress response through multiple mechanisms:

Growth Phase-Dependent Regulation:

  • Cardiolipin levels increase during stationary phase in many bacteria

  • The E. coli ClsC enzyme specifically contributes to cardiolipin synthesis during stationary phase

  • This suggests cardiolipin is particularly important during nutrient limitation

Osmotic Stress Response:

  • Cardiolipin synthesis by all Cls enzymes increases with increasing medium osmolarity

  • This helps maintain membrane integrity under hyperosmotic conditions

Relationship to Energy Metabolism:

  • Cardiolipin interacts with respiratory chain complexes and is required for optimal energy production

  • During stress conditions, cardiolipin helps maintain energy production by stabilizing respiratory complexes

Cross-Kingdom Significance:
Research has demonstrated that cardiolipin is important for stress response across kingdoms (bacteria, yeast, plants, and animals) . This suggests conserved mechanisms by which membrane phospholipid composition influences cellular adaptation to environmental challenges.

What are the implications of cardiolipin synthase structure for designing bacterial-specific inhibitors?

The structural and mechanistic differences between bacterial and eukaryotic cardiolipin synthases present opportunities for designing selective inhibitors:

Key Structural Features:

  • Bacterial cardiolipin synthases (including from Erwinia carotovora) belong to the phospholipase D superfamily

  • They contain conserved HKD catalytic motifs essential for function

  • The active site architecture accommodates two phospholipid substrates

Potential Inhibitor Design Strategies:

  • Transition-State Analogs: Design compounds that mimic the transition state of the phosphatidyl transfer reaction

  • Active Site Targeting: Develop molecules that interact with catalytic HKD motifs

  • Allosteric Inhibitors: Target unique regulatory sites specific to bacterial enzymes

  • Substrate Analogs: Create modified phospholipid derivatives that compete with natural substrates

Selectivity Considerations:
The fact that bacterial cardiolipin synthases use different catalytic mechanisms from eukaryotic enzymes provides a basis for selective inhibition. Specifically, compounds that interfere with the condensation of two phosphatidylglycerol molecules (bacterial mechanism) might not affect the CDP-diacylglycerol-dependent synthesis (eukaryotic mechanism) .

The essential nature of cardiolipin synthase in some bacteria like T. brucei suggests that inhibitors could have potent antimicrobial effects, though essentiality has not been established for all bacterial species.

What are optimal conditions for expressing and purifying recombinant Erwinia carotovora cardiolipin synthase?

Based on established protocols for similar membrane proteins, the following conditions are recommended:

Expression System:

  • E. coli BL21(DE3) strain with pET or similar expression vectors

  • Use of fusion tags (His6, MBP, or GST) to aid solubility and purification

  • Codon optimization for E. coli if necessary

Expression Conditions:

  • Induction at lower temperatures (16-25°C) to improve folding

  • Extended induction times (16-24 hours)

  • Lower IPTG concentrations (0.1-0.5 mM)

  • Addition of membrane-stabilizing agents (glycerol 5-10%)

Purification Strategy:

  • Cell lysis via French press or sonication in buffer containing:

    • 50 mM HEPES or Tris buffer, pH 7.5-8.0

    • 150-300 mM NaCl

    • 10% glycerol

    • Protease inhibitors

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using mild detergents:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl β-D-glucopyranoside (OG)

    • Digitonin

  • Affinity chromatography (Ni-NTA for His-tagged proteins)

  • Size exclusion chromatography for final purification

Storage Conditions:

  • 50% glycerol in Tris-based buffer at -20°C or -80°C for extended storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How can we effectively study the role of cardiolipin in bacterial membrane function?

Several complementary approaches can be employed:

Genetic Approaches:

  • Gene Deletion/Knockdown:

    • Create single, double, or triple cls mutants as established for E. coli

    • Use conditional expression systems for essential genes

  • Site-Directed Mutagenesis:

    • Target catalytic residues in HKD motifs

    • Modify substrate-binding regions

Biochemical and Biophysical Approaches:

  • Lipid Profiling:

    • Thin-layer chromatography for basic analysis

    • Mass spectrometry for detailed profiling of cardiolipin species

    • Radiolabeling studies to track cardiolipin synthesis rates

  • Membrane Property Analyses:

    • Fluorescence anisotropy to measure membrane fluidity

    • Differential scanning calorimetry for phase transition temperatures

    • Atomic force microscopy for membrane organization

  • Protein-Lipid Interactions:

    • Co-immunoprecipitation of cardiolipin-binding proteins

    • Blue-native gel electrophoresis to study respiratory complex stability

    • Fluorescence resonance energy transfer (FRET) with labeled cardiolipin

Structural Studies:

  • Cryo-Electron Microscopy:

    • Visualize cardiolipin-rich domains

    • Study membrane protein complexes in native lipid environments

  • X-ray Crystallography or NMR:

    • Determine cardiolipin synthase structure

    • Study cardiolipin-protein complexes

What techniques can be used to visualize cardiolipin distribution in bacterial membranes?

Researchers can employ several complementary techniques to visualize cardiolipin distribution:

Fluorescent Probes:

  • NAO (10-N-nonyl acridine orange):

    • Binds specifically to cardiolipin in bacterial membranes

    • Shows green-to-red emission shift when bound to cardiolipin

    • Can be used for live-cell imaging

  • Modified Cardiolipin Analogs:

    • Topfluor-cardiolipin

    • NBD-cardiolipin

Microscopy Techniques:

  • Confocal Microscopy:

    • Standard approach for visualizing fluorescently labeled cardiolipin

    • Provides optical sectioning of bacterial cells

  • Super-Resolution Microscopy:

    • STED (Stimulated Emission Depletion)

    • PALM/STORM (Photoactivated Localization/Stochastic Optical Reconstruction Microscopy)

    • Improves resolution to ~20-50 nm, allowing visualization of cardiolipin microdomains

  • Freeze-Fracture Electron Microscopy:

    • Can reveal membrane organization and domains

    • Combined with immunogold labeling for specific detection

Mass Spectrometry Imaging:

  • MALDI-TOF imaging mass spectrometry

  • Secondary ion mass spectrometry (SIMS)

  • Provides spatial distribution of cardiolipin species based on their mass-to-charge ratios

How can mass spectrometry be optimized for cardiolipin analysis in bacterial systems?

Mass spectrometry is a powerful tool for cardiolipin analysis, but requires specific optimization:

Sample Preparation:

  • Extraction Methods:

    • Modified Bligh and Dyer extraction

    • Butanol-methanol extraction (less prone to cardiolipin loss)

    • Internal standards (odd-chain cardiolipin species) should be added for quantification

  • Enrichment Strategies:

    • Thin-layer chromatography pre-fractionation

    • Solid-phase extraction

    • Hydrophilic interaction liquid chromatography (HILIC)

MS Approaches:

  • Negative Ion Mode ESI-MS:

    • Cardiolipins ionize efficiently in negative mode as doubly-charged [M-2H]²⁻ ions

    • Common adducts include [M-H]⁻, [M+Na-2H]⁻, [M+K-2H]⁻

  • Multiple Reaction Monitoring (MRM):

    • Targets specific cardiolipin species for improved sensitivity

    • Useful for low-abundance cardiolipin species

  • High-Resolution MS:

    • Orbitrap or Q-TOF instruments provide accurate mass measurements

    • Resolves complex cardiolipin mixtures

Fragmentation Strategies:

  • Collision-induced dissociation (CID) cleaves fatty acyl chains

  • Neutral loss scanning for phosphatidylglycerol moieties

  • MSⁿ approaches for structural determination

Data Analysis:

  • Software tools like LipidSearch, LipidXplorer, or LIMSA

  • Manual validation of cardiolipin identifications

  • Statistical analysis of changes in cardiolipin profiles

What are the technical challenges in studying the interaction between cardiolipin and respiratory complexes?

Studying cardiolipin-protein interactions presents several technical challenges:

Maintaining Native Interactions:

  • Traditional detergent solubilization can disrupt lipid-protein interactions

  • Newer approaches using styrene-maleic acid copolymer lipid particles (SMALPs) or nanodiscs better preserve native lipid environments

Analytical Challenges:

  • Co-purification Issues:

    • Washing steps during protein purification can remove loosely bound cardiolipin

    • Stringent controls needed to distinguish specific from non-specific interactions

  • Detection Sensitivity:

    • Cardiolipin-protein interactions may be of low affinity

    • Multiple cardiolipin binding sites with different affinities may exist

  • Dynamic Nature:

    • Interactions may be transient or dependent on protein conformational states

    • Environmental conditions (pH, ionic strength) affect interaction strength

Methodological Approaches:

  • Blue-Native PAGE:

    • Can preserve respiratory complexes and supercomplexes

    • Used successfully to demonstrate cardiolipin's role in stabilizing respiratory complexes

  • Crosslinking Mass Spectrometry:

    • Captures transient interactions

    • Identifies specific cardiolipin binding sites

  • Microscale Thermophoresis:

    • Detects interactions in solution

    • Requires minimal sample amounts

  • Cryo-EM:

    • Can visualize bound cardiolipin molecules in protein structures

    • Preserves native conformations

How do environmental conditions affect cardiolipin synthase activity and expression?

Environmental conditions significantly impact cardiolipin synthase activity and expression:

Growth Phase Effects:

  • In E. coli, different cardiolipin synthases (ClsA, ClsB, ClsC) contribute differently depending on growth phase

  • ClsA and ClsB are more active during exponential growth

  • ClsC becomes more important during stationary phase

Osmotic Pressure:

  • Increased medium osmolarity enhances cardiolipin synthesis by all Cls enzymes

  • This suggests a role for cardiolipin in osmotic stress adaptation

pH and Temperature:

  • Optimal pH for most cardiolipin synthases is between 7.0-8.0

  • Temperature affects both enzyme activity and membrane fluidity

  • At lower temperatures, bacteria often modify cardiolipin fatty acid composition

Nutrient Availability:

  • Phosphate limitation can alter cardiolipin synthesis

  • Carbon source affects membrane phospholipid composition

Experimental Methods to Study Environmental Effects:

  • qRT-PCR to measure cls gene expression under different conditions

  • Western blotting to quantify protein levels

  • In vivo labeling with radioactive precursors to measure synthesis rates

  • Lipidomics to analyze changes in cardiolipin species composition

How does cardiolipin remodeling affect bacterial physiology and stress response?

Beyond initial synthesis, cardiolipin undergoes remodeling that significantly impacts bacterial function:

Remodeling Mechanisms:

  • In bacteria, phospholipases release fatty acids from cardiolipin

  • Acyltransferases can reintroduce different fatty acids

  • This process alters cardiolipin's physical properties and interactions

Physiological Implications:

  • Membrane Fluidity Adaptation:

    • Changing fatty acid composition affects membrane fluidity

    • Allows adaptation to temperature fluctuations

  • Stress Response:

    • Remodeling increases during various stresses

    • Modified cardiolipin species may interact differently with respiratory complexes

  • Energy Metabolism:

    • Cardiolipin remodeling affects oxidative phosphorylation efficiency

    • Impacts ATP production under challenging conditions

Research Methods:

  • Pulse-Chase Experiments:

    • Track incorporation of labeled fatty acids into existing cardiolipin

    • Measure turnover rates

  • Lipidomic Time Course Analysis:

    • Monitor changes in cardiolipin species composition during stress response

    • Identify stress-specific cardiolipin signatures

  • Genetic Approaches:

    • Identify and manipulate genes involved in bacterial cardiolipin remodeling

    • Study phenotypic consequences

What are the emerging applications of recombinant cardiolipin synthase in synthetic biology?

Recombinant cardiolipin synthases offer several promising applications in synthetic biology:

Membrane Engineering:

  • Creation of artificial membranes with controlled cardiolipin content

  • Development of cardiolipin-rich nanoparticles for drug delivery

  • Design of minimal cells with optimized energy production

Bioremediation Applications:

  • Engineering bacteria with enhanced stress tolerance via modified cardiolipin content

  • Improving survival in contaminated environments

Biotechnology Applications:

  • Enzyme Production:

    • In vitro synthesis of cardiolipin with defined fatty acid composition

    • Production of cardiolipin analogs for research and therapeutic applications

  • Biosensor Development:

    • Cardiolipin-containing membranes as sensing elements

    • Detection of compounds that interact with cardiolipin

Methodological Approaches:

  • Cell-Free Expression Systems:

    • Expression of cardiolipin synthase in liposomes or nanodiscs

    • Control of reaction conditions for optimal activity

  • Directed Evolution:

    • Engineering cardiolipin synthases with altered substrate specificity

    • Development of enzymes with enhanced stability or activity

  • Synthetic Biology Circuits:

    • Integration of cardiolipin synthase expression with stress-response pathways

    • Creation of bacteria with environment-responsive membrane composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.